KEGG   Clostridium formicaceticum: BJL90_20910Help
Entry
BJL90_20910       CDS       T05005                                 

Definition
(GenBank) hypothetical protein
Organism
cfm  Clostridium formicaceticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HDOD HD_6
Motif
Other DBs
NCBI-ProteinID: AOY78103
UniProt: A0A1D9FS30
Position
4499213..4499701
Genome map
AA seq 162 aa AA seqDB search
MLYRIKQFFQGVTAKIYDEDIVFIKSHLSEKEQNLFFQLRKSEQRHCLNVAYGCHQEAPQ
NPDLVKAALLHDIGKIGSNLTLVNKSFVVIIQKLKLKGKMLPPFLQKALHYKNNHAELGY
QLLLKLQLNDRILFLVRNHHTDHIKDSKEREMEILQRFDNLY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctctatagaataaaacagttttttcaaggtgtaaccgctaaaatttatgatgaagat
atcgtctttataaaaagtcacttaagtgaaaaagaacaaaacttattttttcaattaaga
aaaagtgagcaaagacattgtttgaatgtcgcctatggatgtcatcaagaagcaccccag
aacccagaccttgtgaaagctgctcttttacacgacattggtaaaatcggtagcaattta
acgctagtaaataaatcctttgttgtaatcatacaaaaactcaagctcaagggaaagatg
ttacctcccttccttcaaaaagctttgcattataaaaataatcatgctgagttaggctat
caactgcttcttaaactgcaactaaatgatagaatcttgtttttagtgaggaatcatcat
acagatcatataaaagactcaaaagaaagagaaatggaaatcctacagcgctttgataat
ttatattaa

DBGET integrated database retrieval system