KEGG   Clostridium formicaceticum: BJL90_20965Help
Entry
BJL90_20965       CDS       T05005                                 

Definition
(GenBank) hypothetical protein
  KO
K09776  uncharacterized protein
Organism
cfm  Clostridium formicaceticum
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BJL90_20965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNaseH_like SRI CmlA_N YppF AHH
Motif
Other DBs
NCBI-ProteinID: AOY78114
UniProt: A0A1D9FS49
Position
complement(4511286..4511768)
Genome map
AA seq 160 aa AA seqDB search
MKSITYGEISFDKVCEKIKEYTSEDLALEYVISVGTDSQNVDGYTKMVSVIALVRKRKGG
IFFYDIKKVKKIKNLRQKILKETQYSIELASNIMDFINQNHIKASLEVHVDIGTHGDTKY
LIKEIVGWVIGSGFKCCVKPDSYTSTGIADKISKKGSKVC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtattacttatggagagatcagctttgacaaagtttgtgaaaagattaaggaa
tatacaagtgaggacttggcgctagagtatgttatttctgtaggtacggattctcaaaat
gtagatggctatacaaagatggtttctgttattgcgttagttcgtaaaagaaaaggtggc
atttttttctatgatataaaaaaggtaaaaaaaattaagaatttaagacaaaaaatttta
aaagaaacacagtacagcattgaattagcgtcgaatatcatggattttattaatcaaaat
catatcaaggcttcattagaagtacatgtagacattggtacccatggggatacaaaatat
cttattaaggagattgtagggtgggtcataggttcagggtttaaatgctgtgtgaagccg
gattcctatacatctactggaatcgctgataaaatatctaaaaaaggaagcaaggtctgc
taa

DBGET integrated database retrieval system