KEGG   Clostridium formicaceticum: BJL90_21075Help
Entry
BJL90_21075       CDS       T05005                                 

Definition
(GenBank) hypothetical protein
Organism
cfm  Clostridium formicaceticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C92 DUF2433 DUF2175 Peptidase_M32 GAT
Motif
Other DBs
NCBI-ProteinID: AOY78135
UniProt: A0A1D9FS63
Position
complement(4544154..4544954)
Genome map
AA seq 266 aa AA seqDB search
MKNIKFDDLYPGDVLLCRGEGWLSDLILLFDGGTYSHAALYAGKEGDNHYVIQATQKGIL
KTAPDILSCEIFIDVFRFNKKNHKLGEKEYPYQPIISVGQHYVDEKTKYAFDHLIFLAIL
GITREIPLDITSKKIMRSILDNATAYLFKLLDKGTTPMVCSELVYRCFDEADSEKKYQLT
IEALTLEDFKGILDKEALKIESTNEVVEELDKELIQAKQKFMEVWRKVKQEENTMHALPL
DPVSACVTPKDIEKSPDLEKLGRLQL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaagtttgatgacttatatcctggagatgtgcttttgtgcagaggtgaa
ggatggttatctgacctgattcttctttttgatggaggaacctatagtcatgcagcgtta
tatgcaggaaaggaaggcgataatcattatgttattcaagcaacacaaaaaggaatatta
aaaacagcaccagatatactaagttgtgaaatttttatagacgtttttagatttaataaa
aagaatcataagttaggggaaaaagaatacccctatcaaccgataattagtgtaggtcag
cactatgtagatgaaaaaacaaagtatgcttttgatcatcttatttttttagctatttta
ggaattactagagaaatcccattggacatcaccagcaaaaaaatcatgagaagtatctta
gataatgctacagcctacctttttaagctattggacaagggtactacacctatggtgtgc
tctgaattggtatacagatgctttgatgaagctgattcagaaaaaaaataccagctaact
attgaagccttaaccctagaggatttcaagggaatattagataaagaagctttgaagata
gaaagcaccaatgaagtggtagaggaactagataaagaactgatacaggcaaagcaaaaa
tttatggaagtatggcgtaaagtaaagcaggaagaaaatacgatgcacgcactcccttta
gatccagtttcagcctgtgtaacgccaaaggatattgaaaaatctcctgatctagaaaaa
ttagggagattacagctttga

DBGET integrated database retrieval system