KEGG   Corynebacterium falsenii: CFAL_04750Help
Entry
CFAL_04750        CDS       T03037                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn00071  Fatty acid degradation
cfn00072  Synthesis and degradation of ketone bodies
cfn00280  Valine, leucine and isoleucine degradation
cfn00310  Lysine degradation
cfn00362  Benzoate degradation
cfn00380  Tryptophan metabolism
cfn00620  Pyruvate metabolism
cfn00630  Glyoxylate and dicarboxylate metabolism
cfn00640  Propanoate metabolism
cfn00650  Butanoate metabolism
cfn00900  Terpenoid backbone biosynthesis
cfn01100  Metabolic pathways
cfn01110  Biosynthesis of secondary metabolites
cfn01120  Microbial metabolism in diverse environments
cfn01130  Biosynthesis of antibiotics
cfn01200  Carbon metabolism
cfn01212  Fatty acid metabolism
cfn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFAL_04750
   00630 Glyoxylate and dicarboxylate metabolism
    CFAL_04750
   00640 Propanoate metabolism
    CFAL_04750
   00650 Butanoate metabolism
    CFAL_04750
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFAL_04750
   00072 Synthesis and degradation of ketone bodies
    CFAL_04750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFAL_04750
   00310 Lysine degradation
    CFAL_04750
   00380 Tryptophan metabolism
    CFAL_04750
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFAL_04750
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFAL_04750
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFAL_04750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfn04147]
    CFAL_04750
Enzymes [BR:cfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFAL_04750
Exosome [BR:cfn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFAL_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHI02994
UniProt: W5WP45
Position
1084215..1085531
Genome map
AA seq 438 aa AA seqDB search
MTKGSPRKVAILGGNRIPFARSNKEYASASNQDMLTAAIDGLVARYGLQGEELGQVVAGA
VLKHARDFNLTREVVMGSALSSTTPAFDLQMACGTGLASIVQVADAIAMGRIESGIGGGV
DTTSDAPLAVNDELRKTLIKLNNAKTAGARVKLLGSIRPGQLAPEQPSNGEPRTGLSMGE
HAAITAREFGLTREEQDELAATSHQNLAKAYEEGFFEDLVTPFLGVQRDTNLRPDSTVEK
LAKLKPVFGKRDAEQHGTKATMTAGNSTPLTDGASAVLISSEDWAKEHNIPVQAYLVDSE
IAAVDFIHGRNGMTPDGLLMSPTYAVPRLLERNGLSLQDFDFYEIHEAFASQTLATLKAW
ESAEYCKDRLGLDKPLGSIDRSKLNVKGSSLAAGHPFAATGGRIIATAAKVLEQNGGGRT
LVSICAAGGQGIVAIIER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaaggatccccccggaaggtcgccatcctcggcggcaaccgcattcccttcgcc
cgttccaacaaggaatacgcctccgcatccaaccaggacatgctcaccgccgccatcgac
ggcctggtcgcacgctacggcctgcagggtgaggagctgggccaggtcgtggccggcgcc
gtgctcaagcacgcccgcgacttcaacctgacccgcgaggttgtcatgggctcggccctg
tcctcgaccacccccgcattcgatctgcagatggcctgcggcaccggcctggcctccatc
gtgcaggtcgccgatgccatcgccatgggccgcatcgagtccggcatcggcggcggcgtg
gataccacctccgatgccccgctggccgtcaacgacgagctgcgcaagaccctcatcaag
ctcaacaacgccaagaccgccggcgcccgcgtgaagctgctgggctccatccgcccaggc
cagctcgccccggagcagccctccaacggtgagccccgcaccggcctgtccatgggcgag
cacgccgccatcaccgcccgcgagttcggcctgacccgcgaggagcaggacgagctggct
gccacctcccaccagaacctcgccaaggcctacgaggagggcttcttcgaggacctcgtc
accccattcctcggcgtgcagcgcgataccaacctgcgccccgactccaccgtggagaag
ctggccaagctcaagcccgtcttcggcaagcgcgatgccgagcagcacggcaccaaggcc
actatgaccgccggtaactccaccccgctgaccgacggcgcctccgccgtgctcatctcc
tctgaggactgggccaaggaacacaacatcccggtgcaggcctacctggtcgactccgaa
atcgccgcggtggacttcatccacggccgcaacggcatgacccccgacggcctgctcatg
agccccacctacgccgtgcctcgcctcctggagcgcaacggcctgagcctgcaggacttc
gacttctacgaaatccacgaggccttcgcctcccagaccctggccaccctgaaggcctgg
gaaagcgccgagtactgcaaggaccgcctgggcctggacaagccgctgggctccatcgac
cgctccaagctcaacgttaagggctcctccctggcagccggccaccccttcgccgccacc
ggtggtcgcatcatcgccaccgccgcgaaggttctggagcaaaacggtggcggccgcacc
ctcgtgtccatctgcgccgcaggtggtcagggcatcgtcgccatcatcgagcgctag

DBGET integrated database retrieval system