KEGG   Camponotus floridanus (Florida carpenter ant): 105248916Help
Entry
105248916         CDS       T03919                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00071  Fatty acid degradation
cfo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105248916
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfo03029]
    105248916
Enzymes [BR:cfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105248916
Mitochondrial biogenesis [BR:cfo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105248916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 105248916
NCBI-ProteinID: XP_011252290
UniProt: E2A6C2
Position
Unknown
AA seq 795 aa AA seqDB search
MAEAHSAVAFSFAITHEGWDVNFDREVLHLVWLSGVRSWKKRFFRFLNNLKSGVYPASLE
SLWITIMLVTAVHFAGYKVPYDLVGKVSPYLSGTSILAHLAGSFLVALFLWLAVIYAIRY
TLKLLLMYKGWIYESRGKTYKPSSLTKIWLLMVKLFSGWHKPMLYSFQGSLPRLPLPSVA
DTMTRYLRTVRPLLDDENYARMERLATEFQNGIGVKLQRYLILKSWWSTNYVSDWWEEYV
YLRGRSPLMVNSNFYGIDAILSHPTNLQSARAAAVIYSCLKYRRLIERQELEPILVQGLV
PLCSWQYERVFNTTRIPGIEVDKIVHYQDAKHIVVYHKGRYFKVLIYYRNRILQACEIEL
QIQQILNDDSTPAEGEEKLAALTAGERTIWAQTRKDFFAKGVNKASLDIIEKAAFVVALD
DVAYEYDPNHPEKLDHYGRILLHGKGYDRWFDKSFTLCIGTNGRIGFNAEHSWADAAVMS
HLWEYVICSEFLDREADAPVMGTLWEFIMAADNEIGYQDGHNIGTPEFTPPAPLRLQWDL
NAKCIEAIEQSYQVAHNILNDVELRIYVHDAYGKGLMKANSVSPDAYIQMALQLAYYRDA
GKFSLTYEASMTRLFREGRTETVRPCTIESSKWVKAMENKTITIDEKVKLLMDAVARHQK
SYQDAMCGKGIDRHLFCLYVVSKYLEVDSPFLKEVLSEPWRLSTSQTPHGQTAKLDLKKY
PNCISAGGGFGPVAHDGYGVSYIIAGENLIFFHVSSKRSSSKTDAARFAKEIEKALDDMK
NLLGQKKKIHQNGSA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccactcagccgtagcattcagtttcgcgataacacacgaaggatgggat
gtaaacttcgatcgggaggtgcttcacttggtgtggctttctggagtgcgatcatggaag
aagagattcttccgatttctgaacaatctgaaaagtggcgtttatccagcttctttagaa
agcttgtggattactataatgttagtaacggcggtacattttgctggttataaagttccg
tatgacctcgttggaaaagtatcaccatatctttccggaacctctatactcgcgcacctg
gcaggctcttttctagtcgcattgttcttatggctagcggtcatatacgcaattcgatat
acgttgaaattactgcttatgtacaaaggatggatatacgaatcaaggggtaagacttac
aaaccatcaagtttgacgaaaatctggctcttgatggtaaagttgttctccggttggcat
aaacctatgctatatagcttccaaggatcactgccacgattgccgctaccgtcagtagct
gataccatgacacggtatttgaggactgtacggccattgctagatgacgagaattacgct
cgcatggaaagattggctaccgaattccaaaatggcatcggcgtcaagttgcaacgttat
ttaatcctcaaatcttggtggtctaccaattatgtatccgattggtgggaagagtacgtt
tatttacgtggaagatcacctctgatggttaattcgaatttttatggaattgatgccatt
ctctcgcatcctacgaatctacaatctgcacgagccgcagcggttatatattcctgcttg
aaatatagacgtcttattgaacgtcaagaattagaaccaattctggtacaaggattagta
ccattatgttcttggcaatatgaaagagtttttaatactacacgaattccaggaatagag
gttgacaaaattgtgcattatcaagatgccaaacatattgtagtttatcataaaggcaga
tattttaaggtgttaatttattatcgaaatagaattcttcaagcctgtgaaatagaactt
cagattcaacaaattttaaatgatgattcaacaccggcggagggagaggagaaactagct
gcattaacggctggtgaaagaactatctgggcgcagactagaaaagacttttttgcaaaa
ggtgtaaataaagcttctttggatattattgagaaagctgcattcgtagtcgcattagac
gatgtagcttatgaatatgatccaaatcatccagaaaaattagatcactatggtagaatt
ttattacatggaaaaggatatgatcgatggtttgataaatcttttacgctatgcattggg
accaatggcagaattggcttcaatgcggaacattcttgggcagatgctgcagtcatgtca
cacttgtgggagtacgtgatatgttcggagttcctagacagagaggctgatgcaccggtg
atgggaactctatgggaatttattatggctgctgataatgaaattggatatcaagatgga
cataatataggcactccagaatttacacctccagctccacttcgattgcaatgggatctg
aatgctaaatgtattgaagctattgagcaatcctatcaagtagcacacaatatattgaat
gatgttgagttgcgtatttatgtgcacgatgcttacggcaaaggcttaatgaaggctaat
tccgtatcgccagatgcatatatacaaatggcacttcaactggcatattatcgcgatgct
gggaagttcagtttaacttatgaagcttctatgacgagactattccgagaaggtagaacg
gaaacagttagaccatgcactattgaatcttctaaatgggtgaaagcaatggagaataaa
acaataacgatagatgaaaaagttaaactactaatggatgcggtagcacgacatcagaaa
agttatcaggatgccatgtgtggtaaaggaatagatagacatctattctgtttgtatgta
gtatcaaagtacttagaagtagactcgccatttctaaaggaggttctaagtgaaccatgg
agattatcaacatcacaaactccgcacggtcaaactgcaaaattagatttgaaaaaatat
ccgaattgcatttcagcaggtggtggatttggccctgtagctcatgatggctatggtgtt
tcttacataattgcaggagaaaatcttatatttttccacgtatctagtaaacgatcttcc
tcaaaaacggatgctgcaagatttgcaaaggagatagagaaggcacttgatgatatgaaa
aacttattgggccagaagaagaaaatacatcagaatggatctgcataa

DBGET integrated database retrieval system