KEGG   Camponotus floridanus (Florida carpenter ant): 105249255Help
Entry
105249255         CDS       T03919                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfo01002]
    105249255
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfo04147]
    105249255
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105249255
Peptidases [BR:cfo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105249255
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105249255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S9 DLH LIP
Motif
Other DBs
NCBI-GeneID: 105249255
NCBI-ProteinID: XP_025264812
Position
Unknown
AA seq 359 aa AA seqDB search
MMSSYLLLAVIVPFVIFEIWHTGICLIWTMKASVLIYLVVFGLLPVIFHYSYSIQKKILF
LNFVQWPLKVEFSDPKSVGLEGARNFYLHTDQQVKIGLWQILPRSLLNNSIPATDEAYEA
VLNNSTQPVFLYMHGNSGNRASSHRLELYKLFQDLDYHVIAFDYRSYGDSDIVELSEEGV
VTDSKYVFEWVMKKVNGSVPVFVWGHSLGTGVSAHVLALLAAENIQPAALFLEAPFTNIA
DELIEHPFAQLFKHLPWFHWVVVEPFYKNNLRFESDKHITKIECPIMILHAEDDGVIPIS
LAEKLYKTAIDSHGNNTDRIQMIKIDSSYGLGHKYICRYKKLPSIIKTFVAKANQNQTE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaagttatctactattagcagtgatagtaccattcgtcatctttgagatttgg
catacaggaatatgcttaatttggacaatgaaggcatctgtactgatatatctcgttgtg
tttggacttctgcctgtaatttttcattattcctacagcattcagaaaaagatacttttc
ttaaattttgtgcaatggccacttaaagtggagttttctgatccaaaatcggttggattg
gaaggtgctagaaatttttatttacatactgatcaacaagttaaaataggtttatggcag
atattaccacggtctttattaaataattccattcctgcaacagatgaagcttacgaagca
gttttaaataattccacacaacctgtattcctatatatgcatggaaacagtggtaataga
gcaagttcgcatagacttgagctttataagctttttcaagatttggattatcatgtcata
gcttttgattatagaagttatggcgatagtgatatagtggaactttctgaagaaggtgta
gttacggatagcaaatatgtttttgaatgggttatgaaaaaagttaatggttcagttcca
gtttttgtttggggtcactctttaggaactggagtctctgcgcatgtattagctctacta
gcagctgaaaatatacaaccagctgcattatttctggaagcaccatttaccaacatagcg
gatgaattaatagaacatccatttgcacagttattcaagcatttaccatggttccattgg
gtggttgttgaaccattttacaagaacaatctaagatttgaatctgataaacatattact
aaaattgagtgtcccattatgatattacatgccgaagatgatggtgtaattccaatctcc
ttggcagagaagctttataaaacagcaatagatagtcatggaaataatacagatcgtatt
caaatgataaaaatagattcatcctacggacttggacataagtatatctgtagatacaaa
aaattacccagtataattaagacatttgttgctaaagcaaaccaaaatcagactgaataa

DBGET integrated database retrieval system