KEGG   Camponotus floridanus (Florida carpenter ant): 105249913Help
Entry
105249913         CDS       T03919                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL3
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfo03019]
    105249913
Enzymes [BR:cfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     105249913
Messenger RNA biogenesis [BR:cfo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     105249913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 105249913
NCBI-ProteinID: XP_011253998
UniProt: E2A9M3
Position
Unknown
AA seq 548 aa AA seqDB search
MSDAFEEIQAIKIKRNSYREKLQKRKRERHELYTLTSTSVSSTLTTESACPDSNASSRSD
HSEYERDVLCILHESLPNLPITSADLIDQLRKNLNADVSSSDIHKILEKLATQDIVKIKE
VTENGVFGYTVLSVTESQSSCQSQSDDTENPESVETSTSDPNDHIPSEKQARIEKKNTED
IMSLISMPTIREKESKKVGEQILDLLSKQTSKEKSLAERFRSQGGAQVMEFCPHGTRVDC
VKLNGGPGFAEKCKKLHFKKIIQSHTDESLGDCSFLNTCFHMDTCKYVHYEVDGPTAQPK
ETNDSDSLNNSMPNKTLNLDNKNGGGTSSNVGSELTLYPPQWIQCDLRYLDMTVLGKFAV
IMADPPWDIHMELPYGTMSDDEMRQLGIPALQDEGLLFLWVTGRAMELGRECLQLWGYER
VDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPRINRGLDSDVIVAEVRATSH
KPDEIYGIIERMSPGTRKIELFGRPHNVQPNWITLGNQVDGVHLIDPQLIKAFKKRYPDG
NSMKPAKP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgcatttgaggagatacaagcgatcaaaataaagaggaatagttatcgcgag
aagctacagaaaaggaaacgagaacgacatgaattatatacgctcacttcaacgtcggtt
tcatccaccctgacaacagaatcagcatgtcctgattccaatgcatcttcacgctctgat
cacagcgaatatgaaagagatgtactttgcatcctgcatgaatctctgcctaatctaccg
ataacgtctgcggacttgatagatcagctacgcaaaaatctcaatgctgatgtgtcttct
tccgacattcataagattctagagaaactggccacacaagatatagtcaaaatcaaagaa
gtcacagagaatggagtgtttggatatacagtattatctgtaacagaatctcagtcatca
tgtcaatcccagtccgacgacacggagaatcctgaaagcgtagagacatccacgtccgat
ccaaatgatcacataccttcggaaaaacaagcaaggatagaaaaaaagaatactgaggat
attatgtccttgatttcgatgccgaccatcagagaaaaggagagtaaaaaagtcggcgaa
caaatcttagatttattgtcaaagcagacttccaaggagaaatcgctggctgaacgattt
cgctctcagggaggcgctcaagttatggagttctgtccacatggtacaagagttgactgt
gtaaaattgaacggcggcccaggatttgcagaaaaatgtaaaaagctgcattttaagaag
atcatacagagtcacacagatgaatctttgggcgattgtagctttttaaatacctgcttt
cacatggacacatgcaaatatgtacactatgaggtggatggtcccacagctcaaccaaag
gaaaccaatgattccgatagtctaaacaatagcatgcccaacaagacgctgaacttggat
aataagaatggtggtggtaccagtagcaatgtaggcagcgaattgactctgtatccacca
caatggattcaatgtgacttacgttatctcgatatgacagttcttggcaaatttgctgta
atcatggctgatccaccatgggatattcatatggaattaccttatggcactatgtcagat
gacgagatgagacaattgggaattccagcccttcaggatgaaggacttctgttcttgtgg
gtaactggcagagccatggaattaggaagagaatgtttacagttgtggggctatgagagg
gttgatgagattatttgggtgaagaccaatcaactacaaagaataatacggactggtaga
acgggacattggctaaatcatggcaaagaacattgtttagttggcatgaagggcaatcct
cgtatcaatcgaggactggacagtgacgtgatcgtcgccgaggtacgtgcaactagtcat
aagcctgacgaaatttatggcatcatcgagcgcatgagcccgggcacaagaaaaatcgaa
ttgttcggtaggccgcataatgtgcagcccaattggatcactttaggtaatcaagttgat
ggtgttcatttaattgatccacaactcatcaaagccttcaagaaacgttatcccgatgga
aattcaatgaaacctgctaaaccataa

DBGET integrated database retrieval system