KEGG   Camponotus floridanus (Florida carpenter ant): 105250345Help
Entry
105250345         CDS       T03919                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4 isoform X1
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105250345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfo01001]
    105250345
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfo03036]
    105250345
Enzymes [BR:cfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     105250345
Protein kinases [BR:cfo01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   105250345
Chromosome and associated proteins [BR:cfo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105250345
   Centrosome duplication proteins
    Regulators of centriole replication
     105250345
  Sister chromatid separation proteins
   Polo kinases
    105250345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal Kinase-like RIO1 POLO_box APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 105250345
NCBI-ProteinID: XP_011254676
UniProt: E2AAW4
Position
Unknown
AA seq 786 aa AA seqDB search
MVIDDRRRPVERDMRHHVMPALSAGFGEHIEEYEVLNLLGKGGYGSVYRAKCLRSGMEVA
IKMIDKKMMQAAGMVGRVRQEVEIHSRLKHPAILELYTCFEDANYVYLILELCHNGELQR
FLKAQGTKALPEENAARIIRQVVQGLLYLHSHQILHRDMSLSNLLLTRDMQVKIADFGLA
TQLTKPDEKHVTMCGTPNYISPEVATRSSHGPEADVWSLGCMLYTLLVGKPPFDTDAVKS
TLTRVVMADYIMPSYLSDNAKDLIEKLLRKNPKERIRLRDIHKHPFITNIERNRLYNEKN
DIGGKDLLTNGMIDSGLGRTLSSYGRSKVRSRSEERTSTTPIMPMISMRSEALSEPVAKI
QSNYRVRYGNYAKEDSVLLGIPSFRRVFSQNEQYNNYNEYDHLEKQKMIVRNNKPKKEKS
AENHNVEGTEESVKLQVPPLNTNRLQPTRHRTNTAILTLLDNGEVCTEFVKRKNGREKIS
DVCRISGDGLRVVLYKPVTTEVGSQPPPLPSRGADSIYSYENLPACHHRKYMYAYRFVQL
VQAKTPKLTLYTQRSKCVFMENGPQPDCEVHFYNGVQIIRVNGVIKITDHNGDTFVEGEF
PSHLESYCEHYSECYKRCLLLESTLTSLEAATGHPCFPVIIGRRPSTALNDVPYLQGKEN
ISHIRNVSPVLPSFNGSCSVVSTMTSRSRKMNSMHSLNNANKVAVPGVGFATRLSSGDIR
VDYKDGSALTVSPQNQDSITYESNDGVIVRYNKHHQQNLEVPVQEKLRQLPMVIQYLMEP
RHICIR
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggttatcgatgatcgacgacgtccggtcgagcgcgatatgcggcatcatgtcatgcca
gcgctctcggccggctttggcgaacacattgaggagtacgaggtgctgaatctgctgggc
aagggcggctacgggagcgtttatcgagcgaaatgcctccgcagcggcatggaagtcgcg
atcaaaatgatcgacaagaaaatgatgcaggctgctgggatggtgggtagagtaaggcaa
gaagtggagatacattcgcgattaaaacatccggctatcttggagttgtacacatgtttt
gaagatgcaaactatgtgtatttaattttagaattatgtcataatggggaacttcaacgc
tttctcaaagcgcagggcaccaaagctttacctgaagaaaatgctgcccgcataattaga
caagttgtacaaggtttactttacctccattcccatcaaatacttcacagagatatgtca
ttgtctaatctacttttgaccagagatatgcaagtgaaaatagcagattttggattagct
acacaattaactaaaccagatgaaaaacatgtgaccatgtgcggcacaccaaactacatt
tctcctgaagttgctacaagatcctcacatggaccagaggcggatgtatggagtttggga
tgtatgttgtatactttattggtgggtaaaccaccattcgacactgatgcagttaagagt
actttaacgcgagtagtaatggctgattacataatgccatcttatttgtcggataatgca
aaagatttaatagaaaaattactgagaaaaaatccgaaagagaggatacgtctacgggat
attcacaaacatccatttataacaaatatagaaagaaataggctatataatgaaaaaaat
gacataggaggtaaagatttattaactaatggtatgatagattctgggctaggtaggaca
ctatcctcatacggtcggtcgaaagtgcgatctcggtcggaggaaagaacgtcgacaacg
ccgataatgcctatgattagtatgagaagcgaggcattatctgaacctgttgcaaaaata
caatcaaattacagagtgagatacgggaattacgcgaaagaagactctgtgctgctaggt
attccatcatttcgcagggtgttctcgcaaaacgagcagtacaacaattacaatgaatat
gatcatttagagaagcagaaaatgatagtaaggaacaataaaccaaaaaaggaaaagagc
gcggaaaatcataatgtggaaggaactgaggaaagcgtaaagttacaagtacctcctttg
aataccaatagattacaacccactagacacagaacgaacaccgcgattcttacgcttcta
gacaatggagaagtgtgcactgagtttgttaaacgtaaaaatggcagggaaaaaatcagc
gatgtgtgcagaatatcaggcgatggtctacgtgtcgttctttacaaaccagtaactaca
gaagttggctcgcaaccaccaccattgcccagtcgaggtgctgatagtatttattcctat
gagaatttaccagcatgtcatcatcgaaaatacatgtacgcgtatcgtttcgtgcaatta
gttcaggcgaaaactccaaaattaacgctgtatacccagcgttcaaaatgtgtcttcatg
gagaatggtccacagcctgactgtgaagtgcatttttacaatggagtgcagatcattcga
gtaaatggtgtcataaaaatcaccgatcacaatggtgatacatttgttgagggtgaattt
ccatcgcatctcgaaagctattgcgaacattactcggagtgctataaacgatgtttacta
ctggaatccactttgacgtctttggaggcggccactgggcatccttgttttcctgtgata
attggacgaaggcctagcacggctttgaatgatgttccctatttacagggaaaagaaaat
atatcgcatattagaaatgtttctcccgtcttgccgtcattcaatggtagctgttccgtc
gtttcgacgatgacttctagatcgcgcaagatgaattctatgcatagtttgaataatgca
aataaagtagcggtaccaggagttggattcgctacaagattatcgtccggtgatatccga
gttgactacaaagacgggtccgctttaactgtaagtccgcaaaatcaagatagcatcaca
tacgaaagtaatgatggtgttattgtacgatataataagcatcaccagcaaaatttggaa
gtgccagttcaagagaaacttcgtcaattgccaatggttatccaatatctcatggaacca
aggcacatatgtatccggtag

DBGET integrated database retrieval system