KEGG   Camponotus floridanus (Florida carpenter ant): 105251877Help
Entry
105251877         CDS       T03919                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00520  Amino sugar and nucleotide sugar metabolism
cfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    105251877
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     105251877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 105251877
NCBI-ProteinID: XP_011257256
UniProt: E2AFM4
Position
Unknown
AA seq 405 aa AA seqDB search
MGVLKQFCNCRILRDSRIQTEDLWVRDGRIINPERIFYDEKIKPDVKIDCGGALISPGYI
DVQINGGFGIDFSFNVNNVEEGIDRVAKGLLTHGVTSFCPTLVTSPSEIYHKILPRIKKR
NGGSHGACVLGVHTEGPFISPNKKGAHPEHYIKKFDQGFKSVIDMYGDLDNICMFTLAPE
IPNAISVIEELCKRNIKVSLGHSIANLNEGEEAVKHGASFITHLFNAMLPFHHRDPGLVG
LLTSDKIPFGRIVHFGIISDGIHTHPAALRIAHRTHPEGLVLVTDAISALGLEEGIHQLG
QFKIEKRKGCAYIAGTDTLCGSITEMSKCVRYFKDATGCTVVEALEAATLHPARSLGIDS
YKGILNFGADADFILLDEKLELLSTWISGECVYEKIPGSTKQLEV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcctcaagcaattctgcaattgcagaatcctgcgcgatagcaggatccagacg
gaggatttatgggttcgcgatggaaggattatcaatccggagaggattttctacgatgag
aaaatcaagccagatgttaagatagactgcggcggcgccctgatttcaccgggatacata
gatgtgcagatcaatggaggatttggcatagatttctcattcaatgtcaacaatgtagaa
gagggtattgatagagtagcgaaaggattgctaacacatggagtaacatcattttgtcct
actttggtaacatcccccagtgaaatatatcacaaaatattaccaagaataaaaaaacga
aatggtggtagtcatggtgcttgtgtactgggtgttcatacagaaggaccatttattagt
ccaaataagaaaggcgctcatccagaacattatattaaaaaatttgatcagggatttaaa
tcagttattgatatgtatggagatctggacaatatatgtatgttcacgttagcacctgaa
attccaaatgctatatctgttattgaagaattatgtaaaagaaatatcaaagtatctctt
ggacattccatagcgaatttaaatgaaggagaagaggcagttaaacatggagcatcattt
attactcatttgttcaatgctatgttaccttttcatcatagagatccaggattagttggt
cttttaacatctgataaaattccatttggaagaattgttcattttggcataatctctgat
gggattcatactcatccagcggcattgcgaatcgctcatagaacgcatcctgaaggttta
gtacttgtaacagacgcaatatcagcgttgggtttggaagaaggaatccatcaattagga
caattcaaaatagagaaacgtaaaggatgcgcctacatcgctggaacggatactttgtgt
ggtagcataactgaaatgtccaagtgtgtaagatattttaaagatgctacaggttgcaca
gtagtcgaagctttggaagcggcgactttgcatccagcgaggagcctcggtattgattct
tacaaaggtattcttaattttggagccgatgccgattttatattactggatgagaagtta
gagcttctgtcgacatggatttcgggagaatgcgtttatgagaagattcctggcagcaca
aaacaactggaagtgtaa

DBGET integrated database retrieval system