KEGG   Camponotus floridanus (Florida carpenter ant): 105252391Help
Entry
105252391         CDS       T03919                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00010  Glycolysis / Gluconeogenesis
cfo00562  Inositol phosphate metabolism
cfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105252391
   00562 Inositol phosphate metabolism
    105252391
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105252391
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105252391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105252391
NCBI-ProteinID: XP_011258076
Position
Unknown
AA seq 480 aa AA seqDB search
MCALLLVLVTSLLAFSNVHVSVARDVDFCFADEDDPYLYMATKTAYHFVHGGKTRFQIVP
NCRPVQIWMLAAHGTRCPTVDEINEIVALTDVKEHILNNHETRGEGHLCNRDLENLRRWQ
PDDYLSPQRAEVLTPQGVEDMRLLARRLQSNFPELLLPDASNITPANYKFRATEARESMA
SFMEGLFGSRVAVLSEDSPLNDTLLMAYKTCGVWKNDKQHEQSLEDTERRKFDAGSEFQN
LLKNVSRRLGFLNNISTERIDAMYDACRYEKAWTVTKLSPWCAVFSKEELRILEYREDLD
YYYKAGYGRNINARLGCPLLRNMMQHFGNIARDQMSGEPTGIFYFSDIISLQNLLTAMGI
NEDSTQLTNYNYKDMARRQWRTSMISSYAANLIAVFYKCNDSNDRNKVMFYLAEKPVRYD
GCQVGLCDWEFLKRKFDNLVSSCKHDVCSELNGASSSFPDSIAILLVCVVLVRLGYSRQL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcgttgttgttagtgctagtcacgtcgctcttggccttttcgaatgtccatgtg
tccgtcgcgcgcgacgtcgacttctgtttcgcggatgaggatgatccgtatctgtacatg
gccacaaagactgcatatcatttcgttcacggtggcaagacccggtttcaaatagtaccg
aattgtcgaccggtgcaaatctggatgctcgcagcacacggtactcgctgcccgaccgtt
gacgagatcaacgaaatcgtcgctttaaccgatgtcaaagagcatatactcaacaatcat
gaaacgcgtggtgagggtcacttgtgcaatcgagatctggagaatctgcgaagatggcag
ccggacgattatttgtccccgcagcgggcggaagttctgacgccacaaggggtggaggac
atgaggttactggcgagaaggttgcagagcaattttccggaactattattgcccgatgcc
agcaatatcacgcctgccaattacaagttccgtgctactgaagcgcgcgaaagtatggca
tcttttatggagggtctattcggaagcagggtagccgtgctttccgaggacagtcctctt
aatgatactttacttatggcatataaaacatgcggagtatggaaaaacgataaacagcat
gaacaatcgctcgaagatacggaacgtaggaaatttgatgctggatcagaatttcagaat
cttttgaagaatgtcagccgacgacttggttttctaaacaatatctctaccgaaagaatc
gacgcaatgtacgacgcctgtcgatacgagaaagcttggaccgtgaccaaactttcacct
tggtgtgccgtctttagcaaagaagagctccgcattttggagtatagggaggatcttgat
tactattataaagcaggctacggacgaaatatcaatgctcgtctaggatgtcctcttctg
cgcaacatgatgcaacatttcgggaatatagcgagggatcaaatgtcgggcgaacccaca
ggcatcttctactttagtgacataatcagtctgcaaaatctcctaactgcgatgggcata
aacgaggactcgacgcagttgaccaattacaattacaaggacatggctagacgacagtgg
cgtacatctatgatatcatcctacgccgcgaatctcatcgccgtattttacaaatgtaat
gacagcaacgatcgcaataaagtaatgttttacctggcggaaaaaccagtgcgatacgat
ggctgccaagttggtctctgcgactgggaatttttgaagaggaaattcgataacttggtg
tccagttgtaaacacgatgtctgttcggaactaaatggagcatcttccagcttcccagat
tccatagctatcctattagtatgcgttgttctagtccgccttggttatagtcgacaactg
taa

DBGET integrated database retrieval system