KEGG   Camponotus floridanus (Florida carpenter ant): 105253851Help
Entry
105253851         CDS       T03919                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00051  Fructose and mannose metabolism
cfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105253851
Enzymes [BR:cfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     105253851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-GeneID: 105253851
NCBI-ProteinID: XP_011260480
UniProt: E2ALK9
Position
Unknown
AA seq 436 aa AA seqDB search
MIDAKIIDIKVQDIRFPTSLHYHGSDAMHTDPDYSCAYVTIITDTEYEGYGLTFTLGRGT
EIVVLACKSLFKIIKNKKTTKIFSNFALYWRKLTCDTQLRWIGPEKGVIHLATAAIVNAL
WDLWARIENKPVWKLLTDMSPKELVSTIDFRYIKSVVTKEQAIQILENNMKQKEHQESEL
QKKGFPAYTTQVGWLGYSDEQVVDLCNSSLERGFTAFKIKVGQNLDDDIRRCEIVRRVIG
PEKKLMLDANQVWEIDEAVEWIDRLAIYKPFWVEEPTSPDDSWGHGQIRERLKEKVKLAT
GEMCANRVMFRQFLEMGIDYCQIDAARIGGINEILAVYFMAHIKNLPICPHAGGVGLCEM
VQHLQMWDYICLSQTNEDRMIEYVDQQHEQFEDPVCIKNACYMPPSRPGYSTKLKDECIL
EYAYPEGNYWKLNKSE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcaaaaattatcgatatcaaagtgcaagacataagatttccgacatcatta
cattaccatggaagcgacgcaatgcatactgatcctgattactcttgtgcatatgtaacg
atcataacagacacagaatatgaagggtatggcctcacatttactctaggaaggggaact
gaaattgttgtactggcatgtaaatccttgtttaaaattataaaaaataaaaaaacaacg
aagatttttagcaattttgcgttatactggagaaaattaacatgtgacacacaattaaga
tggattggaccggagaagggtgtgatacatttagctacagccgctatcgtaaacgcattg
tgggatttatgggcacgtatcgaaaacaaacctgtctggaagcttcttacagacatgtcg
cccaaagagctcgtttccactatcgattttcgatatattaagagtgtagtgaccaaggag
caggcgatacagatacttgagaataatatgaaacagaaagagcatcaagaatcggagctg
caaaaaaaaggatttcccgcgtacacaactcaagtcggatggctgggttacagtgatgaa
caagttgtagatctctgtaattcgtccttggaacgcggttttacggcgttcaaaataaaa
gtgggtcagaatttagacgatgatattagaagatgcgaaatagtgcgccgagtcataggc
cctgagaaaaaattgatgctggatgcgaatcaagtctgggaaatagatgaggcggtagaa
tggatagacagattggcgatatataaacctttctgggtagaggaaccgacgtctcccgac
gatagttggggacatggtcaaataagagaaagactaaaggaaaaagtcaagcttgctacc
ggtgaaatgtgcgcgaatcgcgtcatgtttagacaatttttggagatggggattgattat
tgtcaaatcgacgcggcaaggattggcgggattaatgaaattttggccgtatatttcatg
gcacatataaaaaacttaccaatatgcccacatgctggtggagtaggtttgtgcgaaatg
gttcaacatcttcaaatgtgggattacatttgtttaagccaaaccaatgaagatcgtatg
atagaatatgtggatcaacaacatgaacaatttgaagatcctgtttgtataaaaaatgct
tgttatatgccaccttctcgtcctggatattcaactaagcttaaggacgagtgtattttg
gagtatgcttatccagaaggcaattattggaaattaaataaaagtgagtga

DBGET integrated database retrieval system