KEGG   Camponotus floridanus (Florida carpenter ant): 105254853Help
Entry
105254853         CDS       T03919                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X2
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00450  Selenocompound metabolism
cfo00970  Aminoacyl-tRNA biosynthesis
cfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105254853
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105254853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfo01007]
    105254853
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfo03016]
    105254853
Enzymes [BR:cfo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105254853
Amino acid related enzymes [BR:cfo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105254853
Transfer RNA biogenesis [BR:cfo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105254853
 Prokaryotic type
   Other AARSs
    105254853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_N_5 Anticodon_1 tRNA-synt_1e DUF1091 TRM13
Motif
Other DBs
NCBI-GeneID: 105254853
NCBI-ProteinID: XP_011262093
Position
Unknown
AA seq 976 aa AA seqDB search
MIISTNENNPNALKLIIAAKLIQKTFIVKVVKSGDAVLGRLPTLTVSSGLSLFSVSSALR
LLLPISKELEVLNNRWLEWEISQLQPTILSYTSARTPKILQKSDLWSLLKDLNSELKNKQ
YLIEEHSNLSPAFILSPADISIWVSLWSTILLPDIRNDISKDLSNVNNWLINIEKQPVIQ
ESIKEFNLERGARAIASIEAVSWFPVNATSNNSQLCKPVSSDISPTKEKEMETVSQEELH
NVEKSWTTGQYPEVKENSYPILPKKGERNILVTSALPYVNNVPHLGNIIGCVLSADIFAR
YCRQRNYNTLYISGTDEYGTATEAKALQEKTTPQVICDKFFDIHNDVYRWFGIGFDYFGR
TTTPEQTEIVQAFFLRIKSQGYVSSETVEQLHCESCDRFLADRFVEGTCPRCKYEDARGD
QCDGCSHLVNAVELINPRCKMCNTRPVIKNSIQFFLDLPKIEKRLKEYSITVEKEWSSVA
RAVSKSWLRDGLKPRCITRDLKWGIPVPIEGFENKVFYVWFDAPFGYISITKRYTKEYKK
WWQPLQDTKIDLCQFMAKDNVPFHAIMFPAYLLAANQNYTLIKYLMATEYLNYEDKKFSK
SRGIGVFGTDARDTGIPADVWRFYLAYIRPETQDSNFNWVDLATKNNSELLNNLGNFVNR
ALVFSEKFFNSTVPPIEAEEADWTVLALAQRELSCYINAMEQAKLRDGLKYILAISKHGN
QYMQFQQPWVKVKGTDDNKKRAGTVIAICCNLACLLSALLAPFMPSTAKQLRSQLGLSNK
SYGYIPETITNMLPTWHKIGKPNPLFTKIEDQKIEMLRKKYDGQQETNNGISANKVSDES
ITLEAAITKQGNLVRELKAKRDKSIWQPQVEILLDLKKKLNDLKNNVNTSEKKLPAKNKK
VEPIHAPEQNGDALTDVMALEMAIAKQGNLVRELKAKEDGSIWKPQVEILLEMKQRLMDL
TGTAPVVVDKKSKKKK
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgattatttcaacaaacgagaataacccgaacgcgttgaaattgattatcgcggctaaa
ttgattcaaaagacattcatcgttaaagtcgtgaaatctggcgacgctgttctgggtcgt
ttaccaacgctaactgtatcttcgggattatccttattcagtgtgtcttcagcactgcgt
cttttattacctatatctaaagaattggaggtcctcaataatagatggttggaatgggaa
atttctcaattacagccaactatattaagttatacaagtgcgaggactcctaaaatttta
cagaaatcagacttatggtctttattaaaagatctcaatagtgaattaaaaaacaaacag
tacttaattgaggaacatagtaatttatcaccagcatttatattatcaccagcagatatt
tctatttgggtaagcctttggagtaccatattacttccagatatcagaaatgatatttcc
aaggatctatcaaatgtcaataactggctaattaatattgagaagcagccagttattcag
gaatctatcaaagagtttaacttggagagaggtgcaagagctatcgcaagtattgaagct
gtctcttggtttcctgttaatgcaacctcaaataattcacaactttgcaagccagtatca
agtgatattagcccaactaaagaaaaagagatggaaactgttagtcaagaagaacttcat
aatgtagaaaaaagctggactactggacaatatccagaagtaaaagaaaattcatatccc
atattgcctaaaaaaggcgaaaggaacatattggtaacatcagctcttccatatgttaat
aatgttccacatttgggaaacattatcggttgcgttctttcagctgacatctttgcaaga
tactgcaggcaaagaaattacaatactctttatataagcgggaccgatgaatatggcact
gcaactgaagcgaaagctctgcaagagaaaacaactcctcaagttatttgcgataaattc
tttgatatacataatgatgtttatcgatggtttggtattggattcgattattttggtcgt
actactacacccgaacagacagaaattgtccaagcatttttcttaagaatcaaatcgcaa
ggttacgtatcgagtgagactgtggaacaactacattgtgaatcttgtgatcggtttctc
gctgatagatttgtagagggcacatgtcccagatgcaaatatgaggatgcacgcggtgat
caatgcgatggttgcagtcatcttgtgaatgcagtcgagttaataaatcctcgatgtaag
atgtgtaacactagacctgttattaaaaattcgatacagtttttcttggatttacccaaa
atagaaaaaagattgaaggaatattccattactgtggagaaagagtggtccagcgtcgcg
agagcggtttcgaaatcatggttacgtgatggtcttaagccgcgttgtattactagggac
ttgaaatggggtataccagtcccaatagagggtttcgaaaataaagtgttttacgtctgg
tttgatgcccctttcggatatatcagtattacaaagaggtataccaaagaatataagaaa
tggtggcaacctcttcaggatacaaaaatcgatttgtgccaatttatggcaaaggataac
gttccgttccacgcgataatgtttcccgcttatttactagcggccaatcaaaattatacg
ttgatcaagtatttaatggcaactgaatatctgaattatgaggataagaaattctccaaa
tctagaggcattggcgtatttggaactgatgccagagatactggtattccggcggacgta
tggcgattttatttagcttacattaggccagaaactcaagattctaattttaattgggta
gatttagccacgaaaaacaatagcgaattactgaataaccttggcaattttgtcaacaga
gctctggtattttctgaaaagttcttcaattctaccgtaccaccgatagaagcagaagaa
gctgattggactgtattggcgttggcacaacgcgaattgtcatgttacataaacgcaatg
gagcaagctaaattgagagatggcttgaaatacatattggcgatttcaaaacatggcaat
caatacatgcaatttcaacaaccatgggtaaaagttaaggggaccgacgataacaagaaa
agggctggaactgtcattgcaatttgttgtaatttagcctgccttctatccgctcttttg
gctccttttatgccctctacagctaaacaattgagatctcaactaggtttgagtaataaa
agttatggctacattcctgaaacaataacaaatatgttacctacttggcataaaattggc
aaacccaatccattattcactaaaattgaggatcaaaaaatagaaatgttacgcaagaaa
tatgatggacaacaagagactaataatggaatatcggcaaataaagtttccgatgaaagt
attacattagaagccgccatcacgaagcaaggtaatttagtaagagaattgaaagcgaaa
cgcgataagagtatttggcaacctcaagtagaaatcttgttggacttaaagaaaaagctt
aatgatctcaaaaataacgtaaacacatctgagaaaaaattacccgcgaaaaataagaaa
gtcgaaccgatacatgcaccagaacaaaatggagatgctctaacagacgtgatggcgtta
gaaatggctatcgcgaaacagggaaatcttgtgcgagaattaaaggccaaggaagacgga
agtatatggaagccacaagtggagatattattggaaatgaaacagcgtttaatggatctc
actggaacagcgccagtcgttgttgataagaaatccaagaagaaaaaataa

DBGET integrated database retrieval system