KEGG   Camponotus floridanus (Florida carpenter ant): 105255184Help
Entry
105255184         CDS       T03919                                 

Gene name
Titin
Definition
(RefSeq) titin homolog
  KO
K12567  titin [EC:2.7.11.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfo01001]
    105255184 (Titin)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfo04131]
    105255184 (Titin)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfo04812]
    105255184 (Titin)
   04147 Exosome [BR:cfo04147]
    105255184 (Titin)
Enzymes [BR:cfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105255184 (Titin)
Protein kinases [BR:cfo01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105255184 (Titin)
Membrane trafficking [BR:cfo04131]
 Others
  Actin-binding proteins
   Others
    105255184 (Titin)
Cytoskeleton proteins [BR:cfo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105255184 (Titin)
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105255184 (Titin)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 Y_Y_Y Receptor_2B4 BiPBP_C
Motif
Other DBs
NCBI-GeneID: 105255184
NCBI-ProteinID: XP_011262614
UniProt: E2ARB1
Position
Unknown
AA seq 1385 aa AA seqDB search
MGNATTKDYSKNISVGTNSRKTRWDGPGLPAPPGKPILISGTDETQPDVVAIRWERSPSN
GGSAIVGYLVEHRRLGSSHWVRSSSDLCAFPELTLSGLQPGWRYQFRVRAQNAVGLSRPS
EISEPLTVTLQRAAAACVPHFDLELKDTTVLENEQAEFVVQFSGTPLPKISWLKDGFEIF
SSRRTRIITDNGKSVLLIHQTAHNDEGEIKCTATNRAGHVATRAKLILEASPRIRLPRQY
EDGLLFEQDETIRLKVSLAGKPSPTVTWFHDGELISQDARHIFEVMDGESALKIPDAKRN
DRGEYTVKATNKLGEDVASFLVTVTDRPAAPGKVTVEMTLGRSVTLSWKEPEDDGGCKIG
TYIVEYYRIGWEVWLKATTSRRTSATLTELIEGSEYKFRVKAENPYGVSDPSEESDIVFI
PDLKRRIVTPLSEKSQSHREISRSRGDKREVSFTMPAQRTRSLTREEARTRNDEDSDRFA
YDERSASTQRLTTPISTLDRPSRADSRVTFAPDTLEKEPPVPPVRSRDHASTKQQISPGN
HTDRSNIMADIKDKQDIVVKRERTMSPRPTVTVSSPVEEDFKPRSVSMAKERRSLSPLSM
PRAQEYQKEENRPTSTHLLSFSNSSLKRQTVLNEPMLLSPHNSLQLQKMSREDDEDALHG
SSEFMLVLYPEDETQEENMTNETRRSNKHDIIELTEEESDLIPPPISLSLPELFSPQHEI
VEVMRAAVSSTELLHERAMERFYRAVAAEEASEIAKQKTQLERQTGELALLNVESAQKSS
LLRRLSNSGVTTQNLFVSWQAKKNRRRSSEGQTETTPKIMKHLSPALLPDVEARSDPNLP
SETTMADSWRRSNEDESVERLRRWHETNVPLSEEVQEKSIRTDDEEGMAASITVNRAKEM
EEEINSIETSEESSEEISSADSEDLKSLKSRILARQVIDEEDTYHPRGRPIPHVEPELPQ
ISYDRMTSLETPPVRALTPVSPSNIVPKSILKKPKEEISSDNFDGSVSPEIPIRQISPQP
YEQENIEKVIDVEEKITDFSSISEALKTPTMSESDTDSILSAAEAAKNRRMQSKLRSITP
EEEAEIEARMAVVNQYTEIVREYASHSRHGSAASSRRSSISEDQADLKHRVQEKLAPKLA
DKQEQNEAKLKIKDKDKVDKQVKNNQAPAVVKKEGANSRGTTPAKDTTIAKRGSRPTSRD
QSPAARKRERTTDASSRSSSKTRNRTPSLERNNRSLAKNDLNEQGSRRSKIPSRPSSRSS
SRSNSKERFRATVSAESKSEKLQKALESNKYRAMKKEPEVTKENARKSTPEQTGSKQLAL
EAKNTVRSTVDYITDLTLLMAAMYVYFFKKETLAVPFIALLLYRRIQEEIHGWMPRRWWR
STKKP
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccacgacgaaagattattcgaagaacatctccgtcggcaccaattcgaga
aagacgcgttgggatggtccaggccttccagccccgccaggcaaacctatcttaatatcg
ggtacggacgaaacgcagccggatgttgtggcgatacgatgggagaggtcgccgagtaac
ggtggatcagcgatcgtcggatacttggtcgaacatcgacgactgggctcttctcactgg
gtacgaagcagctccgatctgtgtgcctttccggagctaactctgagcggtctccagcca
ggatggcgctaccaatttcgagtcagagcgcagaatgcagtcggactttcgcggccgagc
gaaatctccgagccgctgacagttaccttacaaagggccgccgcagcttgcgttcctcat
ttcgatctggagctcaaggatacgactgtgctggagaacgaacaggccgagtttgttgta
caattctccggtacaccgttgccgaaaatctcgtggctgaaggacggttttgagattttt
agcagtagacgcactaggattattacagacaacggaaaaagcgttcttctgattcatcaa
actgcgcataacgacgaaggtgaaatcaaatgtaccgccaccaatcgagcgggtcatgtt
gctaccagagctaaattaattctcgaagcatcaccgcggatacggctaccacgtcaatac
gaggacggtttgcttttcgagcaagatgagaccatcagattgaaggtatccttggcaggt
aagccatcgcctactgtcacctggtttcatgacggggagctgatatcccaggatgctaga
cacatatttgaggtgatggacggtgaatcagctttgaaaataccagatgccaaacgaaat
gatcgaggcgaatataccgtcaaagccacgaacaaattgggtgaagatgttgcgtctttt
ctggtcactgtaacagatcggcccgctgctcccggaaaagtgactgtcgaaatgactctt
ggtagatcggtgacattatcgtggaaagaaccagaggatgatggcggatgcaagatcggg
acttacatcgtcgaatattatagaattggctgggaagtgtggcttaaagcaacgacaagc
agacgcaccagcgcaacgttaacagaactgatcgaaggctctgaatataaatttcgggtg
aaggctgaaaatccttacggagtcagcgatcctagcgaagaaagcgacattgtctttatt
ccagatcttaaacgaagaattgtaacacctttgagtgagaagtcgcaaagccacagagaa
atcagtagatctcgcggcgacaaacgcgaggtgagttttactatgccggcgcaaagaact
aggagtttaacgagggaagaagcgagaacgcgaaatgacgaagacagcgatcgtttcgca
tacgatgagcgatctgcttcaacacaacgactcacaacgccgatttctacgctggatagg
ccgtcgagagcagacagtagagtgacatttgcaccggatactttggagaaggaaccacca
gttcctccagttagatccagagatcacgcttccacaaagcaacaaatttctcctggaaat
catacagacagatcgaatattatggcagatataaaagacaagcaagatattgttgtaaag
agagaaagaacaatgtcgcccagaccaaccgtgacagtctcttctccggtcgaggaagat
ttcaaaccacgctcggtatctatggcaaaagaaagaagaagtctttctccgctttcgatg
ccaagagctcaagaataccagaaagaggagaatcgccccacgtctacccatcttttatca
ttttcaaattcgagtctgaaaagacagaccgtcctaaatgaacccatgttactttcaccg
cataatagcctacaattgcaaaagatgtcacgagaggatgatgaagacgctttacacggt
agctcggagtttatgctggttctatacccggaggatgagacgcaagaggaaaatatgacg
aatgaaactcgcagaagtaacaaacatgacataatcgagttgacggaagaggagagcgat
cttataccgccgccaatatcattgtctcttccggaattattcagtccgcagcatgaaata
gtcgaagtgatgcgagcagcggtcagctccaccgaacttctccacgaacgagccatggaa
cgtttctatcgcgcggtcgccgccgaagaggcatccgagattgccaaacagaagacgcag
cttgagaggcaaaccggcgaattggccctattaaatgtcgaatctgctcagaaatcgtct
cttctaagacgcctatccaattctggcgtcacgactcagaatttattcgtctcgtggcaa
gctaaaaagaatcgtcgaagatcgagcgagggacaaaccgaaacaaccccgaaaataatg
aaacatctctcgccggctttgctgccggatgtcgaagccaggtcggatccgaatctcccg
tctgaaacgacgatggccgattcctggaggaggagcaacgaggacgaatctgtagagcgt
ctgcgtagatggcacgaaacgaacgtaccattgtcggaggaggtgcaagaaaaatcgata
cgaacagatgacgaagaggggatggcagcttccataactgtaaacagagccaaggaaatg
gaagaggaaattaatagcatcgaaacttccgaagaatcgtcggaagagattagtagtgcg
gatagcgaagacttgaagtcattaaaatcaaggattctagcgagacaagttatcgatgaa
gaagatacttatcatcctagaggaaggccaattccacatgtcgagccagaattgccacag
atttcgtacgatagaatgacaagcttggagactccacctgtcagagcacttactcctgtc
tcgccgagcaacatagtaccaaaatctatcttgaagaaacccaaggaagaaatttcttca
gataattttgacggatcggtttctccagaaataccaattagacagatatcgccgcagccc
tatgaacaagaaaatatagaaaaggtaattgatgttgaggagaaaatcacagatttttcg
agcatatccgaggctctaaagacacctacaatgtcggaatccgatacagatagcatctta
tcggcagcagaagcggcgaaaaatcgacgaatgcaatcgaaattgcgatccataacacct
gaagaagaggcggaaatagaggccagaatggcagtcgtgaatcaatacaccgagatagtt
cgcgagtacgcgagtcattcgcgacacggtagcgcagccagttctcgaagatcttccatt
tccgaggatcaagcggatctaaagcatcgagtgcaggaaaaacttgcgccgaagctagca
gataaacaagagcagaatgaggcgaaattaaaaattaaagataaggataaagtcgacaaa
caagtaaaaaataatcaagcgccagcagttgtcaaaaaagaaggtgctaattccagaggc
acgactcctgcgaaagacacaacgattgcgaagcgcggaagtagaccgacttcccgagac
caatctccggctgccagaaaaagggaacgaacgacagatgcttcatcgagatcatcctcg
aagactcgaaatcgtacgccttctctggaaagaaacaatcgatcattagcgaaaaacgat
ttaaacgaacaaggctctcgtagatctaaaataccttctcgcccttcctcgcgttcctct
tcgagatcaaactctaaagagaggtttagagcgacggtatcggcggaatcaaaatccgag
aagctgcagaaggcactcgagagtaacaagtatcgagcgatgaaaaaagaacccgaggtt
accaaggaaaatgccaggaaaagcacacccgaacagacaggtagcaagcagttagctctg
gaagctaaaaacacggtcagatcgacagtggactacataaccgatttaacgttgctgatg
gccgcgatgtacgtttatttcttcaaaaaggaaaccttggcggttccgtttatcgctcta
cttctatatcgaagaatacaggaggaaattcacgggtggatgccacgtcgctggtggcgg
tccaccaagaaaccctga

DBGET integrated database retrieval system