KEGG   Camponotus floridanus (Florida carpenter ant): 105255188Help
Entry
105255188         CDS       T03919                                 

Definition
(RefSeq) titin homolog isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfo01001]
    105255188
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfo04131]
    105255188
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfo04812]
    105255188
   04147 Exosome [BR:cfo04147]
    105255188
Enzymes [BR:cfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105255188
Protein kinases [BR:cfo01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105255188
Membrane trafficking [BR:cfo04131]
 Others
  Actin-binding proteins
   Others
    105255188
Cytoskeleton proteins [BR:cfo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105255188
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105255188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Spectrin Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 105255188
NCBI-ProteinID: XP_011262619
Position
Unknown
AA seq 4920 aa AA seqDB search
MSMKNLKATDILEALESKLAYIPGGRDRDERPLIVISVPPELDPTTKPKLESLILYFISI
FSEETKEKGLALIVDARRGAWRVARSCIRLSTNLAGSTAVSVIVVRPDGFWDKRVDSCTK
SHKEGEPIYVTLTRLHVYIDFSQLPYELAGNKAYNHVEWIKKRMKIEDYSRDALELISKM
TNLHQRLNTLDGIRMTQSDDDIESYWEIGTELLSMARHILQSGRNLVSSMSRESSKDALD
MIKEIHKLLDAIELKQMDIENSWIEMERNLDTARIIEDLEQGVSSVTDWILGPADMMLNS
CCQVGFDVSSSEELRRQHEKLELQCRETYGRYAELLHKIDSLPKSRLPEDLKSQRDFMDF
VCRSFASRLERRRNVLITSQRFFRLVSEYFDRTSEVFEKLVMGSRNYNFSQASVKLLTLE
KSQTVLDNLERELVKEGEKLSDILSMPVKDALGREVYVNYNEDIINVKDILDATNARKNI
FNDSVELQKLSLKQVALIHMYESDAEQAVEWLKDLFDVLLRNHMEVGCNTKEIQSQKEEH
QSFQETAKGTYEYGGQLVNGARVLRLSCRISLESNAGIFSRLRQAWRQFRSVSQEQLTRL
RVCAVFHRNVEDHCARLQNLVETVTTLYRATKDEDAVAKSRIRTDIRDILDNREKLLLEV
GRMVRLGRLLKTRLKEPLYQQSMSDAEDTSILGSNLTAVEAISAKLAEVTRLAEKLDARL
CEAGARTRPISIPTAVTSSASSLLSISAISPSGTPIRATSIATAPASAATVSIASSISQI
RPAETTTVVAKSLTPMAEKSDESLLHIPSSHFVENVETSNKDSSAKELTPRSESTAEEYN
VEYYTTATECSITPPPCSRSESFVTSPECEDLSTTAPVTNLDSTWATEMSKVATTEIPST
IAESLSAPNNENQVLKFTEATPNICTTSEMKPTTQIETMDKITDERSGKIVKEVTETTVL
RVSHDIRLGVASYKLTSNIVQDHRQHIDAKNLQNVERVLPAESHEKTDDVHRDLDLSQYK
ESEKYIGKCPTKKIQSDQCMTTKLTKIRDHTLNESSRSNLREYEDASLQDLSRYHEDSGI
DMSPMKKEDNLEGEDFLERARKSGECLKLKILELQPELTRLGASAKEATELSNAHDQVLH
RLRNKQSPVEELLRQADQLIATQRSKAEVYKAMAETLGQAWRDVNQLLERRKEILDRNVL
FQCRATECRESMEALEMACNDTLLPIEIEAVKSFLSKIQDLRKDMLEALMGALREGKMLL
DELKELANEGTLDSRPDTIKDEANHAVLRVERWLEELHDRRRLIETSFRNRKTQLEQCLA
LALLATDLRDLEEILNDRIAALANSCDQLGDSASSAELLLFELKKLQAEAKEFQDRAIKI
TKSTERLVSSGHFAGEQATEQAYAILSVAADYVNDLDQHNTLLNKAMIFFELARSAMTKL
DQLEIQLMTTEHPPYSSRLARFHAQAVTTIEDVTSKPLSEGYALLNVTGRGAPGAEGIKN
TVEELENRKICLMEKCTAHKEESLEISRMLTTFLDKHDALRTWLTSIAEAFLQGHQDMGS
DLTMACDFRRVHCQLLCDLENKSEEVDHLELEILPIIERLDESQKYEMRSKIKNLEDEWT
KTKIAVLKRIDLGTIYIQFHEIIEELTNEMDYIDNELKKCDTLDETKINELERKWKSLEP
LYKKLDDRVKAFLGEAGNIDDSYLDISRACLCVQTLFEKFVNRQLVITESWEKWQTTIEI
TRQRRIECERKVEESIKTLAWITKLETTLYPVITTRSTGIADTLDNLKDVKRQILSELNT
ALQELDSRIKSIRVFVEKDEVKTTEQISERLVQMQEKMNTVVKDYKTLLESLISIFKNLE
EIERKIDQAKQEIERVLSFIRPIDVDSTLNEFNISKTSIAESLLRIRTTSEKIIDTIRLQ
EPLESATQDAEKLKSAIDSVDAEFESFQIETSNRLEKHRRFCIFREDIEKINSDLRDLNE
QLKNVDEKIGDNLSASRAALVAFEQFEQTIITLEEKIETFVKKTEETIFPLTPQMTDEIS
SLQNRWYHLRECIKNTKKRINLSIEYFVLLEEAKQWFREGSKLLVIVARKATTIKASEEI
TSLMQEIDAYIKPGEEQQDKRIEELKRLSTIIFGTDRLPQFNEVVVENRQMLDSFAVVSS
ELRTLSQNLQNAEDLRERLRIEKLEADKKLEAAKIEMAAAEAARMEAENARKLAEQLAAE
TLDKAATEARKLKEEEARKVAPPTVSHSVSAQTDETVVEETITSAMTTKEIHILQKMEIE
KNVPIIQKEASPSRNLVSEETHPTEMRDHVEDAEADKIVSLAPEFTVPLSDATIQEGKEF
SFECRLIGQPTPEIVWYKDGISILNNPDYVTTYTDGICTLKIEETFAEDSARYTCRAFNI
RDSVETSATLTVIETITEEQPSAPVFVKELLPSSAREGNSHRLECTVEGNPLPTVQWYKN
DTNIDNSPDYVITFNNGEAVLKFDEIFLEDKALYTCKATNRWGQSSTTASLDVEPAQIST
KKPYFVTPLSNVMVRTGQRVKLECEAKGEPIPELSWAHDGKPIEETKYHRIQTDGARTSL
VITEAFLKDAGCYTVIAKNEVGEATASCIVSVKGRLLHETSESDIICSDTELIIPKIQLP
LQDLKIQEGRSARLDCVIIGQPEPEVIWYHDEQPVKESSDFQLLFQGDRCSLVIHEAFLD
DAGVYKVVAINTGGEASSQCTLTVTPTSHIADVIDRVQEKEKVLVEGSAPKFARLPTDLL
VAEGEDAIFECAVTGEPKPDLRWYSDDGEVTHSERILIEKKEDGTGLLKILSTIPEDKGN
YVAKAINIHGEAKAFARLVVKTLGDFKRNEEFIQMEEKLIRPAFKEVFEDRRIPEGISTK
FECIVIGKPSPKIQWLFNDRPVHGKDFLVSVSGDRQVLTIPEVGDAHVGTISCVAENAAG
KATCSAKVEIDSGSVRQIAGEIEEVLELVPHFPADIMHPASSSDKHFASEKTYHEGGSDS
QVLTKMSSTVTHSSSTTTKKEFLSSTMTSSLSQSGQEPTSVCTKTTVQSSEQSTSENGAP
PVVQSHKIEEYEKIIQDRPGEMRQEKTVLVSEEMEGMKRDIKANQIQKPSRKPVAPRFVS
PLTGMIVDQGEDIVFEGIIDGFPQPTVLWSKNGQELTIMDNVKISYAHNHVKLELKNVNV
KDAGRYTCTVSNDVGNASSTADLVVKKTIFPPVFGKRLKAQVAKKGDRVIMEVEITGIPE
PTVGWYKNDVPINERPPELRITQQGNCYTLFIDKVKEDDAGKYMVRATNAGGEAQSIADV
AVFEPKPDTMVEVHKTVIYENIQDKSAVQSKGKEEEISSSILTSEQIPAIQPSLLFKPIT
PYKIDTIQKIDGPEMKASKSETISSIIESHESEMKTEQKFHMKLEHKTPSIMESKFRTEQ
IAIKEADERKDVSKPLITTEEKSTIENENIETSTIAKKDALSFFESITKESEAVAKGPKE
MIKLTEEGQVQEAKVGKLTKNYEQATFQEVKKSTEARPSEFQATKKAVQDIFTKLEQGPS
RGVENKLFEFPYESFKPTELKKTAVEESIISDSFISQTESSETMMKSFNLVPEPPPEICY
MPKPGEAKKKHPDVFVKAKQLQESFDKTLSPIDAPIGGVKIFPTPTPKIPEPTKPVEPTF
TIPPPFEFEKKEIFEETCIKRDALLQGKKESKYLKEEKLEPSKYASVSSTSVLRSTSPSR
PWSSSSDVETKSHVSTDLSEYRCHSAASSQEVLRATSPKPSADALAMEKSWAKKYADSNR
KSWPPQVESAQKREWNIPVDECKSSSREFTRKVEETSQGEIKKISTESSANVEKRSWSSK
EEFTEKIAEGSLPTSKLGPIIYNAETIKVDHTVNPAQEKALLEKYMSQRNVEKAETIQKF
EEFTSKRLTEDKELKAPGLVKKVEPVIKSLATSHLTETGIDSIILEPGSPPEIGYIPPPF
VEAPLEHKIEKKEEPPVLPPVLPPKDARITPPPIPAKKSVKPSSPAPSKFIKGSYSHESD
YESDFEGRPKAKWRPYESDNEEPHYRRVRAPVSKEPTRPRSTEPEPLPPSKFESPALFTG
PSKSLITTESSEKTMKKTTFKRHERESKQQQQTSIPLKPGSPPIYVQATAKNNVPKSPST
KKPESPKFKTKVFQQESGYMADTDEPFQQKASSTTTTTQKSFGKRDGTSTMVHTETRTTE
SRTKSFESHSYKSDHLQKEESSFVSSPVCTPTPPKVVQQQHSSLEKSYSSTTSSGLRRFE
SLKETGHSMDQSYKKLEPVEKVLPISPSPSKFVKGDFRESDYESDYDRRTSPSFTKLSVI
DSGKPAKLSKYPTVAATPTKPKTVLLPGSPPEIAYAPPQQPQQQFYEAHTSVPFTNAVGT
ETKKTVKMDESTENTRRIVTVEQTSRVIKFGDPASIQKHQTNYRVPVPKKFVQGQFRESD
YESDADSGRIRAKWTPADSDTEEPYYRRVQPPASKSPRLSSTPVRQTRVVSPMEFDSGPP
TTSLTSQIRKEDVDGTISHQRYQQQRTASGKSDGALQPGSPPEYGFISRSDVKKAADHIA
SRHMSDMTSSFKTKTEKFVSDIQSDLRQSKPILKHPVDSRTTDDGEEPRTYREESRVSEH
GTKQIDPDTGLIYFKYDFGYEFGIILPGEGKKTVESSQKSIQGQRRPSDVDVPITHEFTE
KKANGFAKKGTFLNRQSKPGSKFSSSKTVKWEPTSESEFSEAEDARHLNKKQSSVESSMM
APPSLIIPSSVSPSRWDRITPSPLSLSPSLPSLSPRHSSATGPSSNVDSAGSPWPTSNGV
SSAKEVIQPYLDILPKKAPTFITPLKDIAVVSGQPARFECIVQAEPQPNILWSKDRRIVE
NSASHEIQYRNGVCRLTIMKAFPEDAGTYACTATNSLGSTVTSAHLEVPGNRRSIYTPIS
NT seq 14763 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaaaatctgaaagcgacagacatcctggaggctctagaatcgaagctcgca
tatattccaggcggtcgtgatcgtgacgaacggcctttaatagtaattagtgttcctcca
gaacttgacccaacaacaaaaccgaaactagaatctctcattttatattttatatcgatt
ttcagcgaagaaacgaaagaaaagggtttggctttaatcgtggacgcgcgtcgtggtgca
tggcgcgtagctagatcctgtattaggctatccacgaatctcgcaggatcaacagccgtt
tccgtgatcgtggtacgtcccgatggcttctgggacaaacgcgttgatagttgtaccaag
tcgcataaggagggagaaccaatatacgttactctaacgagattgcacgtttatatcgac
ttttctcaattaccgtacgagttggcaggtaacaaggcatacaatcacgtagaatggatt
aagaaacgtatgaaaatagaagattattcgagagacgcgttagaactaatatcgaagatg
acaaatttacatcaaagattgaatactcttgatggtattcgtatgacgcaatcagacgac
gatatagaatcttattgggagatcggtacagaattgttatcaatggcacgtcacatactt
caatcaggtagaaacctagtcagttctatgagcagagaatcttccaaagatgctttggac
atgattaaagaaattcataaactgctcgatgctatcgaattaaaacagatggacattgaa
aattcgtggatagaaatggaacgaaatttagatactgccagaatcatcgaagatctcgag
cagggtgtatcgagtgtcaccgattggatcctgggtccagcggatatgatgctaaactct
tgctgtcaggtcggtttcgatgtttcttcttccgaggaactgcgaagacagcatgaaaag
cttgagcttcaatgtcgggaaacttatggacgatacgcggaattgctccataaaattgat
agtctcccaaaaagcagactacccgaagacttaaaatctcagagagatttcatggacttt
gtttgtcgtagttttgcttcacgactcgaaagacgtagaaatgtattgattacttcgcag
agatttttcaggcttgtctctgagtactttgatagaacgagtgaagtgtttgaaaagtta
gtcatgggcagcaggaattataatttctctcaggcgagtgttaagcttttaacattggag
aaaagtcaaacagttttagacaatttagagcgcgaactcgtaaaggaaggcgagaaattg
tcggatattctctctatgccggtgaaggatgcgcttggacgagaagtttacgtgaattac
aacgaagatatcataaacgtaaaagatatattagacgcaacaaacgcgaggaaaaatatc
tttaacgatagcgtggaattgcaaaagctatcgttgaaacaagttgccttgatacacatg
tacgagagcgatgccgaacaggctgttgaatggttgaaggatctatttgacgtactactt
cggaatcatatggaagttggatgtaatacaaaggaaatacaatcgcaaaaagaggaacac
caatccttccaggaaactgcaaaggggacttatgaatacggtggtcagttggtaaatggc
gcgcgcgtattaagattatcatgcagaatatctttagagagcaacgctggtatcttctcg
agattgcgacaagcttggcggcaatttcgatccgttagccaggaacagttaaccagattg
cgagtatgcgctgtctttcacaggaacgttgaagatcactgtgccagattgcaaaacttg
gtggaaacggtgacgaccttatatcgtgctacaaaagacgaggatgcagtagcaaaatcg
cgtatcagaacagacataagagatattcttgataatcgagagaaacttttattggaggtt
ggccggatggtgagactgggtcgtctcctcaaaacaagattaaaagaacctctttatcag
caatcgatgtccgatgccgaggacacctcgattctcggcagtaatctgacagctgtggaa
gctatctcggcgaaattggcggaagttacgcgtctcgcggaaaaactggatgcgagacta
tgcgaagccggagctagaactcgaccgatatctattcctaccgctgtgacgtcttccgct
tcgtccttgctctcgatatctgctatatcgccatcaggcacgcccatccgcgcgacttct
attgcaaccgcaccggcatcggctgcgacagtttcgattgcgtcttcaattagtcaaata
cgtccagcggaaactacgactgtggttgccaagtccctaactcctatggcggaaaagtct
gatgagagtttacttcacatcccgagctcacatttcgtagagaatgtcgagacatcgaat
aaagattccagtgccaaggagcttactcctcgtagcgaaagtacggcagaagaatacaat
gtggagtattatacaacggcgactgaatgctcaataactccacctccgtgttccagaagt
gaatcttttgtaacttcgccggaatgcgaagatctttctacaacggcacccgtgacgaat
ctcgattctacttgggccaccgaaatgtctaaagtagcaactaccgaaataccttcaact
atcgcggaatctctttctgctccaaacaatgaaaatcaggtgttaaaatttactgaggcg
acaccaaatatctgcactacgagtgaaatgaaaccaacaacacagattgaaacgatggat
aaaattactgacgagaggtcaggcaaaattgtaaaagaagtaaccgagacgaccgtttta
cgcgtatcgcatgatattcgattaggagtagcctcttataagttaacttctaatattgtg
caagatcatcgacagcatatcgacgcgaagaatttgcaaaatgtagaacgtgtgctacca
gcggaatctcacgaaaaaacagacgatgttcatcgtgatcttgatttatctcagtacaaa
gaatctgagaaatatatcggtaaatgcccgacaaagaagattcaatcggatcaatgtatg
acaacgaaactcacaaagatccgagatcatacattgaatgagagttcgcgctccaatttg
cgagagtacgaggatgcatccttgcaggatctttcacgatatcacgaggatagtggaatc
gacatgtcaccgatgaagaaggaggataatttggaaggcgaagattttctcgaaagagcg
aggaagagtggcgaatgtctgaagctgaaaatactcgagctacaaccagaactaacgaga
ctcggtgcttccgcaaaagaagccacggaactctcgaacgcgcacgaccaagtgttacat
cgattacggaacaagcagagcccggtggaagaattgttacggcaggctgatcaattgatc
gcgacccagagatcaaaagcggaagtatataaggccatggcagagacattgggtcaagcg
tggcgcgatgtaaatcaacttttagaacgtcgaaaggagatacttgaccgaaacgtttta
tttcaatgtcgagcgacagaatgtagagagagtatggaggcattggaaatggcgtgtaat
gacacgttactgccgatcgagatcgaagcggtgaaaagttttttatccaagatccaggat
cttcgcaaagatatgctggaagcgctgatgggcgcgttgcgcgaaggcaagatgttgttg
gacgaactgaaagaattggcgaacgaaggcaccttggactccaggccagatacgattaaa
gacgaagctaatcacgccgtactgcgagttgaaaggtggctggaggagcttcacgacaga
cggcggctaatcgagacgtctttccgcaatagaaaaacccaattagagcaatgcctcgct
ctcgcgttgctcgcgaccgatcttcgcgatctcgaggaaattctcaacgacagaatcgcc
gcgttagcgaacagctgcgatcaattaggtgattctgcatctagcgccgaactgcttctc
ttcgaactgaagaagttgcaagccgaagcaaaggaatttcaagacagagctattaaaata
actaaatcgaccgaacgattagtgtcatcgggacactttgctggcgaacaagcgaccgaa
caggcgtacgcgattcttagcgtcgccgccgattatgtcaacgacttggatcagcataat
acattgttgaacaaggcgatgatctttttcgaacttgcacgatcggctatgacaaagctg
gaccaattggagattcagttgatgacaacggagcatcctccttactcctcgcgacttgcg
cgttttcatgcacaagcggtgactacgatagaagatgtgacttcaaagcccttgtccgaa
ggatacgcgctgctgaatgtcacgggaagaggagcgcctggtgccgagggtataaaaaat
actgtagaagaattggaaaatcgcaagatttgtttgatggaaaagtgtacagctcataaa
gaggaaagcctggaaatttcgaggatgcttaccacattcttggataagcacgacgcgtta
cgaacttggctgaccagcatcgctgaagcctttctgcaagggcatcaagacatgggcagc
gatctgacaatggcatgcgattttcgtcgggttcattgtcaattgctctgcgatcttgag
aataagagtgaggaagtggatcatttagaattggagattcttccaatcatagaacgcctg
gacgagtctcagaaatatgaaatgcgatcgaaaataaaaaatcttgaggacgaatggacg
aaaacaaaaattgcggtgttgaaaagaatcgatttgggtacaatttatatacagtttcac
gaaattatcgaagaattgaccaatgaaatggattatatcgataacgaattgaaaaagtgt
gatacattagatgagaccaaaatcaatgagctggaaagaaaatggaaatctcttgaacct
ctttacaagaaattggatgatcgtgtaaaagcatttctcggtgaagccggcaatatcgat
gactcttatcttgatatatcgcgagcttgcctgtgtgtccagactcttttcgagaaattt
gtgaatcggcaattggttataacagaatcatgggaaaaatggcagactaccatcgaaatt
acgagacagagacgaattgaatgtgagcgaaaagttgaagaaagcataaagacattagcg
tggattacgaaacttgagacaacgttgtatccagtgattacaacacgatccactggaata
gccgatactttggataatttgaaggatgtaaaacgacagattttatctgagttaaacacg
gctcttcaggaattggatagcagaatcaaaagcattcgagtatttgtcgaaaaagatgaa
gttaaaacaaccgagcagatttcagagagacttgtacaaatgcaagaaaagatgaatact
gtcgtcaaggattacaaaacattattggaatctttaatctctatttttaagaatctcgag
gagattgagcgtaaaattgatcaagcaaagcaagagattgaacgtgtattaagttttata
agacctatcgatgtggatagcacattaaacgaattcaacatatcgaaaacgtctattgcg
gaatctttgctacgaatacgtacaacatctgaaaaaataatcgacaccattagactgcag
gaaccattagaatcagcgacacaagatgccgaaaaactcaaaagcgcaatagattccgtg
gacgccgagtttgaatcatttcaaatcgaaacatcaaatcgtctcgaaaaacatcgacga
ttttgcatttttagagaggatatcgaaaagattaactcagatctgcgcgacttgaatgaa
caattaaaaaacgtggatgaaaaaatcggtgacaatttgtcggcatcgagagcggcattg
gttgcttttgaacagtttgaacaaactataataactttggaggaaaaaattgaaacattt
gtgaaaaaaacggaagaaaccatctttccgttaacgccacaaatgacagatgagatttca
tctctgcaaaacagatggtaccatttgagagaatgcattaaaaataccaagaagcgaata
aatttaagtatcgaatatttcgtacttttggaagaagcaaagcaatggtttagagaaggc
agcaaactcttggtaatcgttgcacgtaaggcaacaacgataaaagcgtctgaagaaatc
acaagtttgatgcaagagatcgacgcttatataaaaccgggcgaagaacagcaagataag
aggatcgaagagctcaaacgattatcgacgataattttcggtaccgacaggctcccgcaa
ttcaacgaagtggttgtagaaaatcggcaaatgttggattcttttgcagtcgtttcctcc
gaactgcgcactttgagtcaaaatttgcaaaacgccgaggacctgcgggagaggctgcgc
atcgagaaactggaagctgacaagaaattagaggctgctaaaatagagatggccgcggcg
gaagctgccagaatggaagctgaaaatgcgaggaaacttgcggaacagcttgccgctgag
accttggacaaagctgcaacagaagcgcgaaagttgaaagaggaggaagctcgaaaagtt
gctcctccaactgtctctcattctgtctctgctcaaaccgatgagacagtagttgaagaa
accattacttccgccatgacaaccaaagagattcacattcttcaaaagatggaaatcgag
aaaaatgttccgattattcaaaaggaagctagtccgtcgagaaatcttgtgtccgaggaa
acacatcccactgaaatgcgcgatcacgttgaagacgcagaagcagacaaaatagtttca
ttggctccagaattcacagttcctttaagcgatgcgacgattcaagaaggcaaggaattc
agtttcgagtgtcgcttgattggccaaccgacgccagaaatagtctggtacaaagacgga
atatcgattttgaataatccagactacgtaacgacttatacggacggcatttgtactttg
aaaatagaagagacattcgctgaggattctgcaagatacacttgccgcgcatttaatatt
cgcgactctgtcgaaacatcagccactctcactgtcatagaaactatcactgaagagcaa
ccgagcgctcccgttttcgtgaaagaattgttaccctcttctgcgagagagggaaattca
catagattagaatgcaccgttgagggaaatcctcttccgacagtgcaatggtataagaac
gacaccaacattgataattctccggattacgtcatcacttttaataatggggaagctgtt
ttgaagtttgatgaaattttcttggaggataaagccttgtatacctgtaaagcaacgaat
agatgggggcagtcgtctactactgcttctttagacgtagaacccgcgcaaatttccacc
aagaaaccatattttgtgacaccgttatcaaacgttatggtcaggacaggacaaagggta
aaattggaatgcgaagctaaaggagaaccaattcccgaattaagttgggctcatgacgga
aaaccgattgaggaaactaaatatcataggattcaaacggacggtgcacgaacaagccta
gtcatcacggaagcatttctaaaggatgccgggtgttacacggtgattgccaagaacgag
gtcggagaggctaccgcgtcttgcatcgtttccgtaaaaggacgtttgcttcacgaaacc
agcgagtccgatatcatttgcagcgatacggaactgataattccgaaaattcaattacct
ctgcaggatctcaagatacaagagggacgatcggctagattagattgtgtgattataggt
cagcctgaaccagaggtgatatggtatcacgatgaacaacccgtgaaggagtcgtcagac
tttcagctactcttccaaggtgacagatgctcgctagttattcatgaagcttttctggat
gacgctggagtatacaaagtagtcgccatcaatactggcggtgaagcttctagtcagtgt
acattaacagttacacctacatctcacatcgcggatgtaatcgatcgagtacaagaaaag
gaaaaagtcctcgttgaaggttccgcgccaaagttcgccagacttccgacagatttgctt
gtggctgagggtgaagatgctattttcgaatgtgccgtgactggagaacctaaacctgat
ctgagatggtattcggacgacggtgaagtcactcatagcgaaagaattctgattgagaaa
aaggaagatggaacagggcttttgaaaattttgtcaacgataccggaagataaaggcaat
tatgtggcaaaagccataaatatacatggcgaagcgaaagctttcgccaggctggttgtg
aaaacgctcggtgattttaaaagaaacgaagagtttattcaaatggaagaaaaattgatt
cgaccggcgttcaaagaagtattcgaagaccgaagaatacccgaaggcatctcgacaaaa
tttgaatgcatcgtcatcggtaaaccttctcccaagattcagtggttgtttaatgatcgg
ccggttcatggaaaagatttcctagtttccgttagcggagatcggcaagttttaacgatt
cctgaagtcggagatgcgcacgttggcacgatttcttgtgtagcggaaaacgcagctggt
aaagcgacttgtagcgctaaagtggaaattgatagcggatcagtgagacagattgcaggt
gagatcgaagaagtactcgagttggttccacattttcctgcagacattatgcatcctgca
agcagtagcgataagcacttcgcaagcgagaaaacgtatcatgagggcggtagcgatagt
caagtgctaacgaaaatgtcatcaaccgtcacgcattcctcgtcaacgaccacgaagaag
gaattcctatcgtcaactatgacttcctctttatcgcaatccggacaagaacctaccagt
gtttgcacaaaaacaactgtacaaagttcggagcagtctacttcggaaaacggagcacca
cctgtcgtacagtctcacaaaatcgaggaatacgaaaaaataatacaggatcggcctggt
gaaatgcgacaagagaaaactgttctcgtttctgaagagatggaaggcatgaaacgtgac
atcaaggcgaatcaaattcagaagccatctcggaaaccagtagcacctagattcgtctcg
ccgcttacaggaatgattgtcgatcaaggagaagacattgttttcgagggtattatcgat
ggttttccgcaaccgacggttctatggtcaaagaatggtcaagaattgacaataatggat
aatgtaaaaattagttatgctcataatcacgtgaaattggaactaaaaaatgtcaatgtg
aaagacgctggacgttatacttgtacagtgagcaacgatgttggaaatgctagtagtaca
gccgatctcgttgtcaaaaagacaatatttcccccggttttcggtaaacgtctcaaggct
caagtagcgaagaaaggcgatcgagttattatggaagtagaaatcacaggtatacccgag
ccgacggtcggttggtataaaaatgacgtgccgatcaatgaacgaccaccagaattaaga
attactcaacaaggaaattgttatacattattcatagacaaagttaaagaagatgacgct
ggcaaatacatggtacgtgcgacaaacgccggtggagaagcgcagagcatcgctgatgtt
gcagtttttgaaccaaagcccgatactatggtcgaggtgcataaaactgtcatctacgaa
aacattcaggataaaagtgctgttcagtccaaggggaaggaagaagaaatatcatcgagt
attttgacgagcgaacagatacctgcgatccaaccgagcctattattcaagccaatcaca
ccatacaaaatcgacactatacaaaaaatcgatggaccggaaatgaaggctagtaaatcg
gaaacgatctcgtctattatcgaatctcacgaatccgaaatgaaaacggaacagaagttt
catatgaaactagaacataaaactccatcgatcatggagtccaagtttcgaaccgagcaa
atcgcgataaaggaagctgacgaaagaaaagacgtttcgaagccattgataacaacggaa
gagaaatcaacgatcgaaaatgaaaacatagagacgtctacgattgcaaagaaagatgca
ttgagctttttcgaatctattacgaaagaaagcgaggctgtggcaaaaggaccaaaggaa
atgattaaactaacagaggaggggcaagttcaagaagctaaagttggaaaattaacgaaa
aattatgagcaagcaacctttcaagaggtaaagaaatcgacagaagcaagaccgtcagag
tttcaagcaacaaagaaagccgttcaggatattttcactaaattggaacaaggaccgtca
cgcggagtagaaaataagctgtttgagtttccgtacgaaagttttaagccaacggaatta
aaaaaaacggcggtggaggaaagcataatctctgattcgttcatttcgcaaacggaaagc
tccgaaacgatgatgaaaagtttcaatctggtaccggaaccacctcccgagatatgttac
atgccaaagccgggggaagcaaaaaaaaaacaccctgatgtattcgtcaaggcaaagcag
ctacaagaatcctttgacaagacactttccccaatagacgctcctatcggaggcgtgaag
atctttcctacacccactccgaaaataccggagcctactaaacctgtggagcccacattt
acgataccaccaccgttcgaatttgagaaaaaagaaatattcgaggagacatgtataaag
agagatgcacttctgcaaggaaagaaggaaagcaaatatttgaaggaggaaaagctggaa
ccatcgaaatacgcatctgtatcctcaacgtctgtcttgagaagtacttcccctagcaga
ccatggtcgtcatcatcggatgtggaaactaagtcgcatgtatctacggacttgtcggaa
tacagatgccactcggccgcctctagtcaagaagtcctgagggcaacgtcgcccaaacca
tccgcggacgcactggcgatggaaaaatcctgggcgaagaaatacgcggattcgaataga
aaatcgtggccaccccaggtcgaatccgctcagaaacgcgaatggaatattcccgttgac
gaatgtaagagctcctcgagggaatttacgcggaaggtcgaggagacgtcgcaaggtgaa
ataaagaagattagcacggaatcatccgctaacgtggagaaacgctcgtggagcagtaaa
gaagaatttacggaaaagatagcggagggatctctgcctacgtcaaaacttggtccgata
atttataatgccgagacgattaaagtcgatcatactgtgaatcctgcacaggagaaggct
ctgctcgagaaatacatgagtcagcgcaatgtagaaaaggcggaaacgatacagaaattt
gaagaatttacctcgaaacgcttgacagaagataaagagttaaaggcaccgggcttggta
aagaaagtcgaaccagtcataaaatcgctcgcgacatcgcatctcacggaaacaggaatc
gattcgatcatccttgaaccagggtcacctccggaaattggatatattccaccacccttt
gtagaagctccattggagcataagatagaaaagaaagaagaaccacctgtacttccacct
gtactcccaccgaaagatgcacgtatcacgccgccacctattccagccaaaaaatcggtc
aagccctcgtcgccggctccgtcgaaattcatcaaaggttcgtatagccatgagagcgat
tacgagtctgatttcgaaggtcgtccgaaagcaaagtggaggccatacgaaagcgataat
gaggagccgcattatcgaagagtcagggcacctgtttcgaaagaaccgacgagaccgaga
tctaccgaacccgagccacttccgccctcaaaattcgagtcccccgcgctattcacggga
ccgtccaaatcgctcatcactacagaatcttccgaaaagacgatgaaaaagacgacattt
aaacgacacgagagagaatccaagcagcagcagcaaacctcgattcctttgaaacccggc
tctccaccgatttatgtgcaagcgacagcaaagaataacgttccgaaatctccctccacc
aagaaaccggaatctccgaaattcaagacaaaagtttttcagcaggaaagcggttacatg
gcggacacagatgagccattccaacagaaggcttcgtctacgacaactacgacgcagaaa
tcttttggcaaacgtgatggtacttcaacgatggttcacacggagactcgtaccacggaa
agtaggacgaaatccttcgagagtcacagttacaaatctgatcatttacaaaaagaagaa
tcttctttcgtttcgtcacccgtttgtacaccaacgcctcccaaagttgttcaacaacaa
cacagttcgctcgagaagagttattcctcgacgactagcagcggtttacgcagattcgaa
tccttgaaggaaactgggcattccatggatcagtcgtacaaaaaattggaaccagtggaa
aaggtcctaccaatctctccgagtccttcgaagtttgtgaagggcgatttccgcgagagc
gactatgaaagcgactacgatcgcagaacatcgccaagctttacgaaacttagtgtcatt
gattcaggaaagccagcgaagctgagcaagtatcctacagtagcagcaacaccgacaaag
ccgaagacagttctcttacccggttctccgccggaaatcgcgtatgcgccaccgcagcaa
ccgcaacaacagttttacgaggcgcatacaagcgtgccgtttacaaacgcggtgggcacg
gaaaccaagaaaacagttaagatggacgagtcgacggagaacaccaggagaatcgtcact
gtcgagcaaacgagccgcgtcatcaaattcggggaccccgcgtcgatccagaaacatcaa
acgaattatcgcgtgcctgtaccgaaaaaatttgtgcagggacaatttcgtgaatctgat
tacgagagcgacgcagactccggcagaattcgggcaaaatggaccccggctgatagtgat
acggaggagccgtattaccgaagggttcaaccacccgcgtcgaagagcccgagattatcg
agcaccccggttaggcagacacgcgtcgtgtcgccgatggaatttgacagcggtcctcca
acaacatcgttgacgtcgcagattcgcaaagaggatgtagacggaacgattagtcatcag
agatatcagcagcaacgaacagcttcaggaaagagcgatggcgctttgcagcctggttcg
ccacccgaatacggatttatttcgaggagcgacgtaaaaaaagctgcggatcacatcgcg
tcacgtcacatgagtgacatgacaagcagcttcaaaacgaaaaccgagaaattcgtgagt
gatatccagtcggacttgaggcagagcaagccgattctgaagcatcctgtcgattcgagg
acgacggatgacggtgaggagccgagaacttatagagaagaatcgcgagtctccgaacac
ggaacaaaacaaatcgatccggacactgggctcatatatttcaagtatgactttggttac
gaattcggtatcattttgcctggtgagggcaagaaaacggttgaaagcagtcagaagagc
attcaaggacagagacgtcccagtgacgtagatgtacctataacacatgaatttaccgag
aagaaagcgaatggcttcgcgaaaaagggcacgttcttgaaccgccagagcaagccagga
agcaaatttagcagctcgaagactgtcaagtgggaaccgacgtcggaaagcgagttttcc
gaagccgaggacgcgagacatctcaataaaaagcaatcgagtgtggaaagctcaatgatg
gcacctccgagcctcatcatacctagctccgtgtcaccgtcaagatgggatcgcattaca
cctagcccgctttctcttagtccaagtttgccgagcctatctcccagacatagtagcgct
accggaccatctagcaatgtggactctgcaggctcaccgtggccaacgagcaatggcgta
tcatcggccaaagaagtaattcagccttatcttgacatattaccgaaaaaggctcccacg
ttcatcacgccattgaaggatatcgcggtagtgagcggacaaccggctagattcgaatgt
atcgttcaggctgaaccgcagcctaatatcctttggtccaaggatcgtaggatcgtcgaa
aattctgcgagccacgagattcaatacagaaatggcgtttgtcgtcttaccataatgaaa
gcttttcccgaggatgctggaacttatgcgtgcacggcaacaaacagcctaggttctacc
gtaacttctgctcatttggaggtgccaggtaacagacgatctatatacacccctatttcg
taa

DBGET integrated database retrieval system