KEGG   Camponotus floridanus (Florida carpenter ant): 105256513Help
Entry
105256513         CDS       T03919                                 

Definition
(RefSeq) arginase-1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00220  Arginine biosynthesis
cfo00330  Arginine and proline metabolism
cfo01100  Metabolic pathways
cfo01230  Biosynthesis of amino acids
Module
cfo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    105256513
   00330 Arginine and proline metabolism
    105256513
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     105256513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 105256513
NCBI-ProteinID: XP_011264771
UniProt: E2AVP0
Position
Unknown
AA seq 338 aa AA seqDB search
MNILIKACKIYNKLSIRYYGGKVGIIGVPFDKGQEKEGVAHGPNAIRAANLIYELKTLEL
DVQDYGDILYDTNNISDVNNMSHLGCIASCTSRLSEQVRQVLRDGRQALTIGGDHSLSIG
TIDGHVKEKQDIGVLWVDAHADLNTNKTSESGNVHGMPVALLTSELADYWPYLPNMDWQM
PMLSIRNVAYIGLRSVDRYERLVIEKFGITAFGMEDIERYGIHDVIHMALNKIDPHNSRS
LHVSFDIDALDPLEAPSTGTPVRGGLSLREAINLMEEIYRTRRLSAIDLVEVNPQIGSAQ
DVKITIEAAIHIIQAALGYTRRGLRVPKGVTDIPLQTS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattaattaaagcatgcaaaatttataataaattaagtattcgttattatggt
ggaaaagttggtataataggagtaccattcgataaagggcaggaaaaagaaggcgtagcc
catggaccaaatgcaattagagccgcaaatttaatatatgaattaaaaacattagagttg
gatgtacaagactatggtgatatattatatgatacaaataatataagtgatgtaaataat
atgtcacatttgggttgcatagcaagttgtacaagtcgtttatctgaacaagtccgacaa
gtattacgagatggtaggcaagcactaacaatcggtggtgatcacagtttgagtattggc
actatcgatggacatgtgaaggaaaaacaggatataggagtgttatgggtagatgctcat
gcagatttaaatactaacaaaacgagtgagagtggtaatgtacatggaatgcctgtagca
ttgttaacttctgaattagctgattattggccatatttaccaaacatggattggcaaatg
ccaatgttgtccatcagaaatgtagcttatattggtttgagatcggtggaccgctatgaa
agattagtaattgaaaaatttggtattactgcttttggcatggaagatatagaacgttat
ggtattcacgatgtaatacatatggcactaaataagatagatcctcataactcaagatct
ttacatgttagttttgatatagatgcattagatcctctcgaagcacctagtactggaact
ccagtccgtggaggattgtctctcagagaagcaatcaatcttatggaagaaatatacaga
acgcgccgattgagtgctatagacttagtagaagttaatccacaaattggcagtgcacaa
gatgtaaagattactatagaagcagccatacatattattcaagcagctttaggatatacc
agacgtggtttgagagtgcctaagggtgtaactgatataccactacaaacatcttaa

DBGET integrated database retrieval system