KEGG   Camponotus floridanus (Florida carpenter ant): 105258740Help
Entry
105258740         CDS       T03919                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo03040  Spliceosome
cfo04141  Protein processing in endoplasmic reticulum
cfo04144  Endocytosis
cfo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105258740
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105258740
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105258740
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105258740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfo01009]
    105258740
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cfo03041]
    105258740
   03009 Ribosome biogenesis [BR:cfo03009]
    105258740
   03110 Chaperones and folding catalysts [BR:cfo03110]
    105258740
   04131 Membrane trafficking [BR:cfo04131]
    105258740
   03051 Proteasome [BR:cfo03051]
    105258740
   03029 Mitochondrial biogenesis [BR:cfo03029]
    105258740
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfo04147]
    105258740
Protein phosphatases and associated proteins [BR:cfo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105258740
Spliceosome [BR:cfo03041]
 Complex B
  Other components
   Prp19 complex
    105258740
 Complex C
   Prp19-CDC5 complex
    105258740
Ribosome biogenesis [BR:cfo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105258740
Chaperones and folding catalysts [BR:cfo03110]
 Heat shock proteins
  HSP70 / DNAK
   105258740
Membrane trafficking [BR:cfo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105258740
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105258740
Proteasome [BR:cfo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105258740
Mitochondrial biogenesis [BR:cfo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105258740
Exosome [BR:cfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   105258740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A CRIC_ras_sig DUF2526
Motif
Other DBs
NCBI-GeneID: 105258740
NCBI-ProteinID: XP_011268514
UniProt: E1ZZW6
Position
Unknown
AA seq 643 aa AA seqDB search
MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPSNTIFDAKRLIGRRFDDVTVQSDMKHWPFTVVNDGGKPKIKVSYKGEEKTFFPEEVS
SMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
IAYGLDKKAAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLSSNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRA
RFEELCADLFRSTLEPVEKALRDAKMDKAQVHSIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTI
PTKQTQTFTTYSDNQPGVLVQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAIEKSTGKENKITITNDKGRLSKEEIERMVNEAEKYRSEDELQRERITAKN
ALESYCFNMKTTMEDEKIKDKIDASDKEKIISKCNEIISWLDANQLAEKEEFTDKQKELE
SICNPIVTKLYQSGGAPGGFPGAGGAGPNPGAGGAGPTIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagcaccggcagttggaattgacttgggcaccacgtattcctgcgtgggcgtc
tttcaacacggaaaagtcgaaatcatcgccaatgatcagggtaaccgaactacaccgagc
tacgtagccttcaccgacaccgagagattgatcggcgatgcagcaaaaaaccaggttgcc
atgaaccccagcaacaccatttttgacgcaaagcgtttgatcggtcgccgattcgatgat
gtgactgtacaaagcgacatgaagcattggccgttcacggtagtcaatgatggaggcaaa
ccaaagatcaaggtgtcttacaaaggcgaggagaagaccttcttccccgaggaagtgtcc
tccatggttctaacgaagatgaaggaaacagcggaagcgtatttgggcaagaccgtgacg
aacgccgttattactgtgccagcttatttcaacgattctcaaaggcaggcgacgaaagat
gctggtgctattgctggtctaaatgttcttaggataataaatgaaccgactgcagctgcg
atagcgtatggtctcgataagaaagccgcaggcgaaaagaacgtcctgatctttgacttg
ggcggtggtacctttgacgtgtcaattctgacaatcgaggatggtatcttcgaggtaaaa
tctacggctggcgacacgcatctcggtggtgaggacttcgacaatcgaatggtaaaccac
ttcgtgcaagaattcaagagaaagtacaagaaggacttgagctctaacaagagagctgtg
agacgtctaagaacagcctgtgaaagggcgaagaggacattaagttcgtcgacgcaagca
agcattgagattgactcgttgtttgaaggtatcgatttctacacatcaatcaccagagcc
agattcgaagaactctgcgccgatctgttcagaagcactcttgaacctgtcgagaaagcg
cttagagatgcgaagatggacaaggctcaagttcacagcatagttctagtcggtggctcc
accaggataccaaagattcagaaattacttcaagatttcttcaacggtaaagagctgaat
aaatccattaatccggatgaagccgttgcttatggcgcagcagttcaggcggctatttta
catggtgacaagtctgaggaagttcaagatctacttctactagacgtgactcctttgtca
ttgggcattgaaaccgctggcggtgtcatgacaactttgatcaagaggaatacaacgata
ccaacgaagcaaacccagacatttactacatattccgataatcaaccaggagtacttgtc
caagtctacgaaggggagagagcgatgaccaaggataacaatattcttggtaaattcgaa
ttaactggaataccaccggcacctagaggtgtaccacaaattgaagttacttttgatatc
gatgcgaatggcatattgaatgtctctgcgattgagaaatctacaggcaaagaaaataag
atcacgattaccaatgacaagggacgtttatcgaaggaagagatagaaagaatggtaaat
gaagccgagaaataccggtcagaagatgaactgcaacgagaaagaattactgctaaaaac
gctctcgagtcatattgctttaacatgaagaccacgatggaagatgagaagattaaagat
aagatcgatgcgtctgataaggagaaaattatctctaaatgcaacgaaattatctcgtgg
ttggacgccaatcaattagcggagaaggaagagtttactgacaagcagaaagaactggag
tctatttgcaatcctatcgtaacgaaactttatcaaagcggtggagcacccggtggtttt
cctggtgctggaggagcaggacccaacccaggcgctggtggtgctggtccaactattgaa
gaagtcgattaa

DBGET integrated database retrieval system