KEGG   Camponotus floridanus (Florida carpenter ant): 109610088Help
Entry
109610088         CDS       T03919                                 

Definition
(RefSeq) uncharacterized protein LOC109610088
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00020  Citrate cycle (TCA cycle)
cfo00640  Propanoate metabolism
cfo01100  Metabolic pathways
cfo01200  Carbon metabolism
Module
cfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109610088
   00640 Propanoate metabolism
    109610088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfo04147]
    109610088
Enzymes [BR:cfo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109610088
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109610088
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109610088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp DAGK_acc
Motif
Other DBs
NCBI-GeneID: 109610088
NCBI-ProteinID: XP_019883469
UniProt: E2AHJ6
Position
Unknown
AA seq 947 aa AA seqDB search
MSFMISFLTEICARGINKQLLARKVPIFKQLVRNLEIHEHMAYTLLKEAGIPVPPFGVAK
TPDEAANLAKNLNTKDLVLKAQILAGGRAMGHFKDKDLSGVVMCETPEQVKELTSNMIGK
VLITKQTGAAGKICNSVMVTARMFPRKEHYMAVMLESAFDGPVLIVSKQGGVNIEEIAAV
NPEAVTYIPIDISKGLTSAQADSVGEKLGLAGNNKEIASIIACNLYELFVEKDALLVEIN
PFAEDICGQYYALDCKCKFDDSADFRQKELFTLKDTTQMDPKEVEAEKHNLNYIALDGNI
GCMVNGAGLAMATMDIIKLYGGTPANFLDVGGTATIETVTEGFKILSSDPKVEAILINIF
GGIMRCDIIAQGIIDAFKQLKLHIPIVVRLQGTNVDKAKKLISDAKLEVISVDDFAQAAE
TSVKLALMMNLAKSLNLDIHFTAKLSEKMKIAEKRKKCIKLFFSRKFNRRENCLFGAARH
DSSLDRISYIRESAWPAKMATMLSRTVSLAESLCRLNTPKILACKTNLTKQPVRNLNVHE
HISYSLLNEAGVPTPKFGVAKTADEAAKLAANLKTKDIVLKAQVLAGGRGKGHFKGTNVS
GVKMCETPEEAKSLASHMLGKLLITKQTGEAGRICNAVMVTQRMFPRKEYYLAVMMERAF
GGPVIIASSQGGVNIEEVAATNPNAIMYEPIDINKGITKEQAERIITKLGLDNVKDYISN
IILNLYQMFLKKDALLLEVNPLAEDINGNYFALDCKCRFDDNAEFRQKELFSLRDWSQED
PKEVEAAKFDLNYIALDGNIGCMVNGAGLAMATMDIIKLHGGEPANFLDVGGGASASAVK
EAFKIITSDSRVHALLVNIFGGIMRCDVIAEGIIAATKELSLKIPVVVRLQGTNVDEAKA
LIANAGLKIVPIDDLDEAARVAVKLSTIVKLAQSENLSVNFEIPAIS
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttatgatatcgtttttaacggaaatatgcgctcgaggaataaataaacagcta
ttagcgcgtaaagtgccgatctttaaacaactagtgcgaaatttagagatacatgaacac
atggcgtacactttattgaaggaagccggcattcctgttccgccttttggagtagcgaaa
acacccgacgaagccgccaatctggctaagaatctaaacactaaagatctcgtactaaaa
gcacagattttagccggaggtagagcaatgggacattttaaggataaagatctcagtggc
gttgtaatgtgcgaaactccagagcaagtaaaggaattgacgagcaatatgatcggcaaa
gtgctcataactaaacaaacaggtgcggccggaaagatatgtaattccgtgatggtgaca
gcacgcatgtttccacgtaaggaacattacatggcggtgatgctggaaagtgctttcgat
gggcccgtgttaattgtttccaaacaaggtggcgtaaacatcgaggagatcgccgccgtc
aatcccgaagctgtaacatacataccgatcgacataagtaaaggcttaacgtccgcgcaa
gcggacagtgtcggcgagaagctcggactcgcaggaaacaacaaagaaatcgcatcgatt
atcgcctgtaatctgtatgaattgttcgtcgagaaggacgctctgcttgtcgagatcaac
ccgtttgcggaggatatttgtggtcaatattacgctttagattgcaaatgtaaattcgac
gatagcgccgatttccgacagaaggaattgtttacgttgaaagacacgactcagatggat
ccgaaagaggtcgaagcggaaaaacataatttaaattacatagctctagatggaaatatc
ggctgtatggtaaacggagccggtttagctatggctaccatggacattataaagctctat
ggtggtaccccggcaaatttcttggatgtcggaggtaccgctacaatcgaaaccgtgaca
gaaggtttcaaaatactatcttcagacccgaaagtggaagctattttaataaatatcttt
ggtggtataatgagatgcgacataatcgcccaaggaatcatcgatgcttttaaacagtta
aaattgcatatacctatagttgtgcgattacagggtactaatgtcgataaagctaaaaaa
ttgatatcagatgctaagttagaagtaatttccgtggatgattttgcacaagcagccgag
acatcggttaaattagcattgatgatgaatttggcaaagtctttgaatttagatattcat
ttcactgctaaattatcagaaaaaatgaaaattgccgagaaaagaaagaaatgcatcaaa
ctatttttctcccgcaaattcaaccgacgcgaaaactgcttgtttggcgctgctcgccat
gattcgtcattggatcgaatcagttacatccgcgagtctgcgtggcctgcaaagatggct
accatgttgtcgcggacggtttcactcgcggagagtctctgccgattgaacactcctaag
atattggcatgcaagactaacttgacgaaacaaccagtcaggaatttaaatgtacacgaa
cacatcagctacagtttgctcaatgaagccggcgtacctactccgaaatttggcgttgcc
aaaactgccgatgaagcagccaaactcgctgccaacttgaagacgaaagacattgtcttg
aaggctcaagttcttgctggtggcagagggaagggacacttcaaaggaacgaatgtcagt
ggagtgaagatgtgtgaaaccccagaagaagccaagtcattagcgagtcacatgctaggt
aaattactaataactaaacagaccggcgaggccggcaggatatgtaacgccgtgatggtc
acgcaacgtatgtttccccgtaaagaatactatcttgctgtcatgatggaaagagccttt
ggtggtcccgtcattatagcttccagccaaggtggagtaaatattgaagaagttgctgct
actaatcctaacgcaatcatgtatgaacctatcgacatcaacaagggaattacaaaggag
caagcagaacgcataattaccaagttgggtcttgataatgtgaaggattatatttccaat
ataattctaaatctttaccaaatgtttctcaaaaaggacgctcttcttctagaagtgaat
cctctcgcagaagatattaatgggaattattttgctctggattgcaagtgtcgatttgat
gacaacgctgaattcagacaaaaagagctatttagtctgagggattggtctcaggaggat
cccaaggaagtcgaggctgcaaaattcgatttgaattacattgcgctcgatggcaatata
ggttgtatggtgaatggtgcagggttagctatggctactatggatatcataaaattacat
ggtggcgaaccggctaatttcctcgatgttggtggtggtgcatcggcttctgcagtgaaa
gaagcattcaaaattatcacttctgattcacgagttcacgctcttttagttaatattttt
ggaggcatcatgagatgcgacgtcatagcagagggtattattgctgcgactaaggaatta
agtttaaaaattcccgtcgtcgtaagattgcagggtaccaacgtggacgaagccaaagct
ctaatcgctaatgcgggtttaaaaatcgtgccaatcgacgatttggatgaagcagcccga
gttgcagtaaaattatcgactattgttaaattagcacaatctgaaaatctcagtgtaaat
ttcgaaataccagcgatttcatag

DBGET integrated database retrieval system