KEGG   Camponotus floridanus (Florida carpenter ant): 112638186Help
Entry
112638186         CDS       T03919                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00061  Fatty acid biosynthesis
cfo01100  Metabolic pathways
cfo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112638186
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     112638186
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     112638186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP Epimerase ACT Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 112638186
NCBI-ProteinID: XP_025265123
Position
Unknown
AA seq 249 aa AA seqDB search
MSILVAGKLALVTDAGSGIGREVCRVLAREGANVVAADQNITTAQETVAFLEGTEHIALH
INVEDRNSVKTAFKDVVKQYSKPPTIIVNSAGIVRKIFLMKLDDSNFDDVINVNLKGTFL
VTQIAVKMLIEGNATTNSSIINISSIAANDRYVGYSTYNASKAGVIIMTKSASLEFGQFG
IRVNAVFPGFIDAPMTSHISKEAREMHIKNIPLQRFGKPEEVAEVIVFLASDRSSYINGA
SIEVTGRLN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatactcgtagctggaaaactggcacttgttaccgatgctggaagcggcatcgga
agagaagtatgtcgagttttagctcgtgaaggcgcaaacgttgtcgcagccgatcagaat
atcacaactgctcaggaaactgttgcctttttagaaggtactgaacatattgcattgcat
attaatgttgaggatcgaaacagtgtcaaaactgcgtttaaagatgtcgtgaagcaatat
tcaaagcctcctactatcattgttaattcggcaggcatcgtgcgaaaaatatttttgatg
aaactcgatgacagtaattttgatgatgtcattaatgtcaatttaaaaggtaccttttta
gtgacgcaaattgctgtcaaaatgttgatagagggaaatgcaaccacaaattcctcaatt
atcaatataagttcgattgctgctaatgatagatacgttggatatagtacttataacgcg
tcaaaagctggagtgataattatgacaaagagcgcttcattggagtttggacaatttgga
attcgtgtaaacgcagtatttcctggttttatagacgctcctatgacttcacatatatct
aaggaagctagggaaatgcatataaaaaatattccattacaaagatttggaaagccagaa
gaagtagcagaggttatcgtgtttttagcttctgatagaagttcttacataaatggagcc
tctattgaagttactggaagattgaattag

DBGET integrated database retrieval system