KEGG   Campylobacter fetus subsp. testudinum pet-3: CR44_04100Help
Entry
CR44_04100        CDS       T03583                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cfp  Campylobacter fetus subsp. testudinum pet-3
Pathway
cfp00430  Taurine and hypotaurine metabolism
cfp00620  Pyruvate metabolism
cfp00640  Propanoate metabolism
cfp00680  Methane metabolism
cfp01100  Metabolic pathways
cfp01120  Microbial metabolism in diverse environments
cfp01200  Carbon metabolism
Module
cfp_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CR44_04100
   00640 Propanoate metabolism
    CR44_04100
  09102 Energy metabolism
   00680 Methane metabolism
    CR44_04100
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CR44_04100
Enzymes [BR:cfp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CR44_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJB45412
Position
complement(839713..840912)
Genome map
AA seq 399 aa AA seqDB search
MKILVINSGSSSIKFKLYDMSNESVICKGLIEQIGAKNSYAKIVTKTGETAEKREEIPDH
GTGIDVMNELLFNSHALKSLDEIDGVGHRVVQGADLFNDAVLIDDDVLQKIEELIPLAPL
HNPAHLAGMKETLKVRPDIPNVAVFDTVFHQTMPKSSYMYPLPIEFYEKYKIRRYGAHGT
SHQFVAKAGAKVLGIDFDHFSCITLHLGNGASIAAIKDGKCIDTSMGLTPLEGLMMGTRC
GSIDPAIVPFLMKNANLSGEEIDTIMNKKSGLLAIGGSNDMREIEAKMDAGDENAKLAFE
MFVLRIKKYIGAYISILGEINAIIFTAGIGENDARIREAVCSGLEIFGIRMDKDKNAAKK
DEPRRVGLPETKVRIIIVPTDEELAIAEDTLRIINQSKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttggttataaactcaggtagcagctcgattaaatttaaactttacgatatg
agcaatgaaagcgttatatgcaaaggtttgatagaacaaataggcgcaaaaaactcatat
gcaaaaatagtcacgaaaactggtgaaacggctgaaaaaagagaagaaatcccagatcac
ggcacaggaatagacgtgatgaatgagcttttatttaacagtcacgcattaaaaagtctt
gatgagatagacggcgtaggtcacagagtagttcaaggtgcagatcttttcaatgacgct
gtgcttatagatgatgatgttttacaaaaaatagaagaactcataccgcttgctccactt
cataatccagctcacttagcaggtatgaaagagactttaaaagttagaccagatattcca
aatgtagctgtttttgatactgtttttcatcaaacaatgccaaaaagctcatatatgtac
cctcttccgattgaattttatgaaaaatataaaatacgaagatacggcgctcacggtaca
tcacatcagtttgtagcaaaagccggtgcaaaagttttaggtattgattttgatcatttt
agctgtatcacgctgcaccttggaaacggtgctagtatagcagctataaaagatggaaaa
tgcatcgatacaagtatgggtttaactcctcttgaaggtcttatgatgggaacgagatgt
ggaagcatagatcctgctatcgtaccttttttgatgaaaaacgcaaacttgagcggcgag
gagatcgatactataatgaataaaaaaagcggtcttttagcaataggcggctcaaacgat
atgcgtgagatagaagctaaaatggatgccggagatgaaaatgcaaaacttgcttttgag
atgtttgtactgcgtataaaaaaatatatcggtgcttatatatccatattgggcgagata
aatgctatcatatttaccgctggtataggtgaaaatgatgctagaatcagagaagctgtt
tgtagcggacttgaaatatttggtataagaatggacaaagataaaaatgctgccaaaaaa
gatgagccgcgccgtgttggtcttcctgagacaaaagttcgtatcatcatagttcctact
gatgaagaactagctatagcagaagatacgttgcgtataataaaccaatcaaaaaaataa

DBGET integrated database retrieval system