KEGG   Campylobacter fetus subsp. testudinum pet-3: CR44_04170Help
Entry
CR44_04170        CDS       T03583                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
cfp  Campylobacter fetus subsp. testudinum pet-3
Pathway
cfp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cfp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CR44_04170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfp01007]
    CR44_04170
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfp03016]
    CR44_04170
Enzymes [BR:cfp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     CR44_04170
Amino acid related enzymes [BR:cfp01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CR44_04170
Transfer RNA biogenesis [BR:cfp03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CR44_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DUF4270
Motif
Other DBs
NCBI-ProteinID: AJB45425
Position
852029..854044
Genome map
AA seq 671 aa AA seqDB search
MELLIEIGVEELPAIPFLKELNNIKPKWKQVLDEYGLDSKFNLEYTPRRIVINGDIPELT
PDLEAENIGAPKSVALQDGKWSAAALGFAKKCGISQDELSFKEIKGKEVLYHKSVIKGKL
VFDLLPAMIEKFILSLNFGKSMRWGSGEYEFIRPIRSLISILGKKSVDFEIFGVRSKKAF
YPHRNFGYDMIDFSTIDEYFELLQKNGIILSATQRKEKILNEFKDIEAKNSLKIELDFDL
LDEVVAITEYPTALLGSFEKEFLEVPSEVIITSMKENQRYFPLHDADEKLSNHFVVVSNA
ITNDPNLIIRGNEKVLRARLSDAKFFWHSDLANEFSSEKLKNITYLNELGSMYDKELRER
QIVRVLSSIYDKDLRYEFGGDYADELDRAVMLSKADLTTNMVYEFTNLQGVMGGYYAAYR
DENPFIISAIKEQYLPNANLYPKTLFSSLVAISNKLDTLMGLFSIGKIPSGNKDPYALRR
AASGIIKIVLNLGINFDLRNILNLIKPNYKSFDLNSLESFVYERLYSIYDVNPSVIKACL
NSSQSNLKRLNSAIIALDEICKMEDFKDNFSTFKRLSNIIKDSEIIEVDESLFEENVENE
LNNKFKTLNLNIDDTKTYLEGLFGLKTSIDLFFDSVMINHDNPKIKANRISIIGQIYKAF
LKVADIKEISA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggagttattgattgaaatcggcgttgaagagttgccggcgattccttttttaaaggaa
ctaaataatataaaaccaaaatggaagcaggttttagacgaatacggacttgatagcaaa
ttcaaccttgaatatactccaagaagaatcgtgataaacggcgatataccagaacttacg
cctgatttagaagctgaaaatataggagctccaaaaagcgttgccttacaagatggtaaa
tggagcgcggctgctttgggatttgctaagaagtgcggcataagtcaagatgagcttagt
ttcaaagagatcaaaggcaaagaagttttgtatcataaaagcgttataaaaggcaagctt
gtttttgatttgcttcctgctatgatagagaaatttatattatctttaaattttggaaaa
agtatgagatggggaagtggcgagtatgagtttatacgccctatacgatcattgatctct
attttaggtaagaaaagtgtggattttgaaatttttggcgtgagaagcaaaaaagcattt
tatccgcatagaaatttcggttatgatatgatagatttttctactatagatgagtatttt
gaacttttgcaaaaaaatggaattatactaagtgctactcagagaaaagagaaaatttta
aacgaatttaaagatatagaagctaaaaatagtttgaaaatagagcttgattttgatctt
ttagatgaagttgtggctataacagagtatccaacggcgcttttaggcagttttgaaaaa
gagtttttagaggttccttctgaagttatcattacttcaatgaaggaaaatcaacgctat
tttcctctgcatgatgcagatgaaaaacttagcaaccattttgtagtcgtaagcaacgcc
attacaaatgatccaaatttgataataagaggaaatgaaaaagtcttaagagcaagatta
agcgatgctaagttcttttggcatagtgatttagctaacgagtttagtagtgaaaaacta
aaaaatatcacttatctaaatgagcttggcagtatgtatgataaagaacttagagagaga
caaatcgttagagttttatctagtatctacgataaggatttaagatatgagtttggtgga
gattacgctgatgagcttgatagagccgttatgcttagcaaagccgatcttactactaat
atggtttatgaatttacaaatctccaaggtgtaatgggcgggtattacgctgcatataga
gatgaaaatccatttataataagtgctataaaagagcagtatttgccaaatgcaaattta
tatccaaaaactctattttcaagtttagtagcgatatcaaacaagcttgacaccttaatg
ggactctttagtataggtaagataccaagtggaaataaagatccgtatgcattaagaaga
gcagctagcggaattataaaaatagtactaaatttaggtataaattttgatttgcgaaat
attttaaatttaataaaaccaaattataaaagctttgatttaaactcccttgagagtttt
gtgtatgaaagactttatagtatttatgatgtcaatccttctgttataaaagcgtgttta
aatagctcacagagcaatttaaaaaggttaaactcagctataatcgcacttgatgaaata
tgcaaaatggaggatttcaaagacaatttctctacatttaaacgactatctaatattata
aaagatagcgagattatagaagttgatgagagtttatttgaagaaaatgtggaaaatgaa
ctaaacaataaatttaaaactctaaatttaaatatagacgatacaaaaacgtatcttgag
ggtttgtttggattaaaaactagtatcgatcttttctttgactctgttatgataaatcac
gataatccaaaaataaaagctaatagaatttcgattataggtcaaatttataaagcattt
ttaaaagtggctgatataaaggaaattagcgcttga

DBGET integrated database retrieval system