KEGG   Citrobacter freundii complex sp. CFNIH3: C2U38_00305Help
Entry
C2U38_00305       CDS       T06381                                 

Definition
(GenBank) cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
cfq  Citrobacter freundii complex sp. CFNIH3
Brite
KEGG Orthology (KO) [BR:cfq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U38_00305
Enzymes [BR:cfq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     C2U38_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Haem_bd Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AUV24217
UniProt: A0A2I8S0L8
Position
64672..66066
Genome map
AA seq 464 aa AA seqDB search
MKIITRLTVIAIAGVAICYFGLSGYVWYHDNQRSKQADVQASTLEENNKVLGFLREKGCD
YCHTPSAELPFYSSFPVAKQLMNYDIQLGYKSFNLEAVRAALVADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDTERAEILGWIAKQREQYYASNDTATQHRNEPVQPIPESI
PTDARKVALGFTLYHDPRISGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAPTLQAQAGGPPLNPIEMASKSWDEIIQKLDKDPQLKQEFIAVYPQG
FSGDNITDAIAEFEKTLITPNSPFDKWLRGDEAALTAQQKHGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEVTAADIGRMNVTNELRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDIDDIVAFLESLNGVYTPYMQGK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattacccgtcttaccgtgattgccatagctggcgtcgcgatttgttatttt
ggattatccggttatgtgtggtatcacgataatcaacggagtaaacaggctgatgttcag
gcctctacgctggaagaaaataataaagtactagggttcttacgtgaaaaaggatgcgat
tattgtcacactccttcggctgaattacctttctattcttcttttcccgtcgctaagcag
ttgatgaattacgatattcaactgggatacaaatcattcaatctggaggccgttcgtgcg
gcgctggtcgcggataaacccgtttcgcaaagcgatctgaataaaattgagtgggtgatg
caatacgagaccatgccgccgacgcgttataccgcactgcactgggctggcaaggtaagc
gatacggagcgagcagagatcctgggctggattgcgaaacagcgtgagcagtactacgcc
agtaacgatactgccacgcagcatcgtaatgaacctgtacagccgataccggaaagcatc
ccgaccgatgcccgcaaagtagcgcttggttttacgctttaccatgacccgcgtatttcc
ggcgatagcacgatttcttgcgcgcactgtcacgccctgaatgcgggcggcgtggatggc
cggaaaacgtcaatcggtgtaggcggcgcggttggccctatcaatgcgccaacggtattt
aactcggtctttaacgttgagcaattctgggatggccgtgcgccaacattgcaggcgcag
gccggtggtccaccgttgaaccctatcgaaatggcgtctaaatcctgggatgaaattatc
cagaaactggacaaggatccgcaacttaagcaagagttcattgccgtttatccgcaggga
ttcagtggggataatattaccgatgcgattgctgagtttgagaaaacgctgattacgcca
aattcgccgtttgataaatggctgcgtggtgatgaagcggccttaaccgctcagcaaaaa
catggctatcagttgtttaaagataataagtgcgcgacctgtcatggcggtattatttta
ggcggacgttcatttgagccattgggtctgaaaaaggactttaatttcggcgaggtcact
gctgcagatattggccgcatgaacgtcaccaatgaattacgtgacaagctgcgtcagaaa
gtccctggattgcgtaacgttgcgctgactgcgccttatttccatcgcggtgatgtgcct
acgctcgacggcgcggtaaaactgatgctgcgttatcaggtgggtaaagaactgccgcag
gaagatatcgacgatatcgtagcattcctcgaaagccttaatggggtatatacaccgtat
atgcagggtaaataa

DBGET integrated database retrieval system