KEGG   Camelus ferus (Wild Bactrian camel): 102503486Help
Entry
102503486         CDS       T02979                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04020  Calcium signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04925  Aldosterone synthesis and secretion
cfr05214  Glioma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102503486 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102503486 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    102503486 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102503486 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102503486 (CAMK1G)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102503486 (CAMK1G)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102503486 (CAMK1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Pkinase_fungal Kdo APH RIO1
Motif
Other DBs
NCBI-GeneID: 102503486
NCBI-ProteinID: XP_014411375
Position
Un
AA seq 506 aa AA seqDB search
METAQAWPRTGQRASPEASTLEAMGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEV
FLVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLEDIYESSTHYYLVM
QLVSGGELFDRILERGVYTEKDASLVIRQVLSAVKYLHENGIVHRDLKPENLLYLTPEEN
SKIMITDFGLSKMEQSGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYP
PFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWI
NGNTALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNQHSPGVRPEVGNRQ
PSLPASEALRPSSPEITVTAAPALDQSVGLPALPRLPCQHGPRPXXXXPRPAAPGGRSLN
CLVNGSLRISSSLVPMQQGPLAIGPCGCCSSCLSIGTKGKSSYCSEPTLLKKANKKQNFK
SEVMVPVKAGGSSHCRVGQAGVCLIM
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggagacggcgcaggcctggccgaggacggggcagagagcatccccagaagcttcaact
ctggaggcgatgggtcggaaggaagaagatgactgcagctcctggaagaaacagaccacc
aacatccggaaaacgttcatcttcatggaagtgctgggctcaggagctttctcagaagtt
ttcctggtgaagcaaagggtaactggaaagctctttgccctgaagtgcatcaaaaagtca
cctgccttccgggacagcagcctggagaatgagatcgctgtgttgaaaaagatcaagcat
gaaaacattgtgaccctggaggacatctatgaaagcagcactcactactacctggtcatg
cagcttgtttctggtggggagctctttgaccggattctggaacggggtgtctacacagag
aaggatgccagcctggtgatccggcaggtcttgtcggcagtgaaatacctccacgagaat
ggcatcgtccacagagacttaaagcctgaaaacctgctttacctcacccctgaagagaat
tctaagattatgatcacagactttggtctctccaagatggaacagagtggtgtcatgtcc
actgcctgtgggaccccaggctatgtcgctccagaagtgttggcccagaagccctacagc
aaggctgtggattgctggtccatcggagtcatcacttacatattgctgtgtgggtatccc
cctttctatgaagaaactgagtctaagctttttgagaagatcaaggagggctactacgag
tttgagtctccattctgggatgacatttctgagtcagccaaggattttatttgtcacttg
ctggagaaggacccgaatgagcggtacacctgtgagaaggccttgaggcacccctggatt
aacggcaacacagccctccaccgggacatctacccatcagtcagcctccagatccagaag
aacttcgccaagagcaagtggaggcaagccttcaatgcggcggccgtggtgcaccacatg
aggaagctgcacatgaaccagcacagcccgggggtccgcccggaggtggggaacaggcag
cccagcctgccggcctccgaagccttgaggcccagctccccggagatcaccgtcaccgcg
gcacctgccctggaccagagcgtggggctccccgccctgccccgcctgccctgccagcac
ggcccccggcccnnnnnnnnnnnnccccggcccgctgccccagggggcaggtccctcaac
tgcctggtcaatggctcgctccgcatcagcagcagcctggtgcccatgcagcaggggccc
ctggccatcgggccctgtggctgctgttccagctgcctgagcatcgggaccaaagggaag
tcctcctactgctccgagcccacactcctcaaaaaggccaacaaaaaacagaacttcaaa
tcagaggtcatggtgccagtgaaagcaggcggcagctcccactgccgggtggggcaggcc
ggagtctgtctcattatgtga

DBGET integrated database retrieval system