KEGG   Camelus ferus (Wild Bactrian camel): 102503604Help
Entry
102503604         CDS       T02979                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04217  Necroptosis
cfr04650  Natural killer cell mediated cytotoxicity
cfr04722  Neurotrophin signaling pathway
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr04940  Type I diabetes mellitus
cfr05142  Chagas disease (American trypanosomiasis)
cfr05143  African trypanosomiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05320  Autoimmune thyroid disease
cfr05330  Allograft rejection
cfr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102503604 (FASLG)
   04010 MAPK signaling pathway
    102503604 (FASLG)
   04068 FoxO signaling pathway
    102503604 (FASLG)
   04151 PI3K-Akt signaling pathway
    102503604 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102503604 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102503604 (FASLG)
   04217 Necroptosis
    102503604 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102503604 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102503604 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102503604 (FASLG)
   05205 Proteoglycans in cancer
    102503604 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102503604 (FASLG)
   05330 Allograft rejection
    102503604 (FASLG)
   05332 Graft-versus-host disease
    102503604 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102503604 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102503604 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102503604 (FASLG)
   05162 Measles
    102503604 (FASLG)
   05164 Influenza A
    102503604 (FASLG)
   05161 Hepatitis B
    102503604 (FASLG)
   05160 Hepatitis C
    102503604 (FASLG)
   05168 Herpes simplex virus 1 infection
    102503604 (FASLG)
   05163 Human cytomegalovirus infection
    102503604 (FASLG)
   05165 Human papillomavirus infection
    102503604 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102503604 (FASLG)
   05143 African trypanosomiasis
    102503604 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102503604 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102503604 (FASLG)
   04052 Cytokines and growth factors [BR:cfr04052]
    102503604 (FASLG)
   04090 CD molecules [BR:cfr04090]
    102503604 (FASLG)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102503604 (FASLG)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Tumor necrosis fators
   102503604 (FASLG)
CD molecules [BR:cfr04090]
 Proteins
  102503604 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LapA_dom
Motif
Other DBs
NCBI-GeneID: 102503604
NCBI-ProteinID: XP_006187754
Position
Un
AA seq 283 aa AA seqDB search
MQQSLNYPYPPIFWVDSSASSPWASPRSVFPCPSSAPGRPGQGRPPPPPPPPPPPTLPPR
PPPPLPPLPLPPLKKRRDHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELREST
SQRQTASSLEKQIGQPHPPSEKRELRKVAHLTGKPSSRSIPLEWEDTYGIALVSGVKYKK
GSLVINDTGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSRYPQDLVLMEGKMMNYCTTGQM
WARSSYLGAVFNLTSADHLYVNVSELSLVNFEESKTFFGLYKL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtccctgaattacccgtaccccccaatcttctgggtggacagcagtgccagc
tctccctgggcctctccacggtcggtcttcccctgtccatcctctgcgccaggaaggcct
gggcaagggaggccaccgccgccaccaccaccaccaccaccaccaacactaccgccacgg
ccaccaccgccactgcctccactaccactgccacctctgaagaagaggagggaccacagc
acaggcctgtgtctccttgtgatgtttttcatggttctggtggccctggttggactgggg
ctggggatgtttcagctcttccacctgcagaaggagctggcggaactcagagagtccacc
agccaaaggcaaacagcctcatctttggagaagcaaataggtcagccccatccaccctct
gagaaaagagagctgaggaaagtggcccatttaacaggcaagcccagctcaaggtctatc
cctctggaatgggaagacacctacggaattgccctggtctctggggtgaagtataagaag
ggcagccttgtgatcaatgacaccgggctgtatttcgtgtattccaaagtgtacttccgg
ggccagtcctgcaacaaccagcccctgaaccacaaggtctacatgaggaactctaggtat
ccccaggacctggtgctgatggaggggaagatgatgaattactgcactactggccagatg
tgggcccgcagcagctacctgggggccgtgttcaatctcaccagtgctgaccatttatat
gtcaatgtatctgagctctctctggtcaattttgaggagtctaagacattttttggctta
tataagctctaa

DBGET integrated database retrieval system