KEGG   Camelus ferus (Wild Bactrian camel): 102503815
Entry
102503815         CDS       T02979                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102503815 (AKAP5)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102503815 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102503815
NCBI-ProteinID: XP_032338072
Position
6
AA seq 427 aa
METTVSEIQVENKDEKRLAEVSPQEERQEEKASMLCFKRRKKAAKAMKPKAGSETADAAR
KCSPEAGASDQPQPPGGAWASIKRLVTRRKRSDSSKQQKSFEAEVQPEINAEDADPSKKK
AKSRLKIPCIKFSKGEKRKHSKIIEDSDRSIKMQAEAESLDTKTLTQSDDKATKTKSTQD
IREDVSQKEGDEVCESNVNNSITSGEKVILVELELDTGHSAIQTGTLILEKDIETIEEKQ
SVQPQQASPLETPDTECQLPVVSDVPPSPALPDQQIVEGARNDTLESGPNWKDHESRETV
TEESEPKDTELSQESDFKENEITAEKPKPEESKRMEPIAIIITDTEISEFDVQKSKNVPK
QFLISVENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
TINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaaacaaggatgagaagagattggcagaa
gttagtcctcaggaggagaggcaggaggaaaaagcatcaatgctttgcttcaagagaaga
aagaaagcagccaaagcaatgaagcccaaagctggctctgaaactgctgatgcagcaagg
aagtgctccccagaagcaggagcttctgatcagccacagcccccaggaggggcctgggcc
tcaatcaaacgccttgtaacacgcaggaaaaggtcagattcttcaaagcagcaaaagtcc
tttgaggctgaggtgcaacctgaaatcaatgctgaggatgctgatccttctaagaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggggagaaaaggaagcat
tccaaaattatagaagactcagaccgcagcatcaaaatgcaggcagaggctgagagtttg
gatacaaaaactctgacccagtcagatgacaaggcaacaaagaccaagtcgacccaggat
ataagggaagatgtctcacagaaagagggtgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctggagagaaagtgattttggtagaactggagttagatacggggcattct
gctattcaaacaggaactctaatccttgaaaaagatattgaaacgattgaggaaaaacaa
agcgttcaacctcagcaagcaagcccactggaaactccagatacagaatgtcagcttcca
gtagtttctgatgttcctccctcacctgcactcccagatcaacaaattgtggaaggagcc
agaaatgataccctagaaagtggaccaaactggaaagaccatgaaagtagagagactgta
actgaggagagtgagccaaaagatactgaattgagccaggaatcagattttaaagaaaat
gagatcacagcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgctatt
attatcacagacaccgaaatcagtgaatttgatgttcagaagtctaaaaatgtccctaag
cagttcttaatttcagttgaaaatgagcaagtaggggtttttgctaatgatagtggtttt
gagggtagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctcttgtc
aagaatgctatccagttgtccatagaacagctggttaatgaaatggcctctgatgataat
acaataaacaatcttctacagtga

DBGET integrated database retrieval system