KEGG   Camelus ferus (Wild Bactrian camel): 102503859
Entry
102503859         CDS       T02979                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102503859 (AHRR)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102503859 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 102503859
NCBI-ProteinID: XP_032325003
Position
3
AA seq 751 aa
MRARAPYRLPGSVGSGAGRLACRGGAVLPRLQPPPGPRDASAGSRAATAPGLGRLLPRAR
LSLRAPLAGRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISKLDKLSVLRLSVS
YLRVKSFFQALQERRPQQPAASAPPPGDRGPCGGSAVPEGRLLLESLRGFALVVSAEGVI
FYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFRRQLHWAMDPPPAACGQPLLAETGE
DAILGRLLRAQEGGASSPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKFLFGQKR
KAPSGAALPPRLSLFCVAEPVLLPSVAEMKVKSVLLRVKHRGDISATTDTKAKATGSLCE
SELYGKPNHLTGRGDGENSISVFRAPADACCWARVPARVPCLCLRGRPDLVFDPEGAAGD
GGGEALGGLLSGSLGLREQRDTYMSSCRLETLGPTKHLNWKSSQDSGAKLKLEPSQSDPF
SAHTPPHGACLPHPGVQGTIQASSAVAFRNCPGSHPPKHPPGACAGRTSRALQDGHQGQM
HPPASCPFPQGSLDNGHPQPGAQCFPPGGYPTEDKLRGVLMPMGALCNPMSLDVPIKMES
DSGPEDASDGYSVSPGQVWLGAGDVAKRQLATFPSRMHLKTEPDSRHHLCSPLLGPGMLG
AHPRPSRELAPFHPSRCACLGPPARLCVRGHQPPAPGYDGRAPGATPVVKREPLDSPPWA
APSQGGAPGMFPGSALATRKPPRDSMCAFLP
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgcgcgcgcgcgccccctaccgcctccccggctcggttggctccggggcggggcggctc
gcgtgccggggtggggccgtccttccgcggctgcagccgccgcctggtccccgagatgcg
agtgccggcagtcgagccgccacagcgcctggtctgggccgtctcctcccgcgggcgcgc
ctgagccttcgcgccccgctggccgggaggcctgccgtgggggctgagaagtcaaaccct
tccaagcggcaccgggaccgcctcaatgctgagctggaccacctggccagcctgctgcca
ctcccacctgacatcatctctaagctggacaagctctcggtcctgcgtctaagtgtcagt
tacctcagggtgaagagcttcttccaagccctgcaggagcggcgcccacagcagccggct
gccagtgcccccccaccaggagacagaggtccgtgcggagggtccgccgtgccggaggga
aggctgctgctggagtccctccgcggctttgctctggtcgtgagcgccgaaggcgtgata
ttctacgcgtcagcgacgatcgcggactacctgggcttccaccagacagacgtgatgcac
cagaacatctacgactacatccacgtggacgaccgccaggacttccgccggcagctccac
tgggccatggaccccccaccggcggcgtgtgggcagcccctgctcgcagagacaggagag
gacgccatcctggggaggctgctgcgggcccaggaggggggcgccagctcgcccacggag
tactcggccttcttgacgcgctgcttcgtctgccgtgtgcgctgcctgctggacagcacc
tcgggcttcctgacgatgcagtttcaaggaaaactaaaattcctgtttgggcagaagagg
aaggcgccgtcgggcgcagccctgccgcctcgcctctccctgttctgtgtggcagagccg
gtgctcctgccttccgtggcagagatgaaggtgaagagcgtgcttctgagggtgaagcac
agaggggacatctcggccacgacggacaccaaagcaaaagctactgggagtctgtgtgaa
tcagaattgtatggaaaacccaatcatttaacaggaaggggcgatggggaaaacagcatt
tccgtgttcagggcaccagcggacgcctgctgctgggcccgggttccagcccgggtcccc
tgcctgtgcctcaggggccgcccagatctcgtctttgaccccgagggggctgcaggggac
gggggaggagaggcgctcggggggctgctgagcggctccttgggactgagggagcagaga
gacacgtacatgtccagctgccgcctagagacactaggacccacgaagcacctgaactgg
aaatccagtcaggacagcggcgctaagctgaagctggagcccagccagagcgacccgttc
tctgcacataccccgccccatggcgcctgcctgcctcacccaggtgtgcagggcaccatc
caggccagcagcgctgtggccttcaggaactgccccggctctcaccccccaaaacatccc
ccaggtgcctgcgccggccggaccagcagagccttgcaggatggccatcagggccaaatg
caccctcctgccagctgccccttcccccaggggagcctggacaatgggcaccctcagccg
ggagcacagtgtttcccaccaggtggctatcccaccgaggacaagttgcgaggtgtcctg
atgcctatgggagccctgtgtaaccccatgtcactcgatgtgcccatcaagatggagagt
gactctgggcccgaggacgcatcagatggctactctgtgtccccaggccaggtgtggctg
ggggccggcgatgtggccaagagacagctggccactttcccgagcaggatgcacctgaaa
acagagccggactccaggcaccacctctgcagtccgctcctgggtcccggcatgctgggg
gcccaccctaggcccagcagggagctggccccattccacccctcacgctgcgcctgcctg
gggcctccagcccgcctctgtgtgcggggccaccagccccctgctccgggctacgatggc
agagctcctggggccacgcctgtcgtcaagcgcgagcccttggactcgcccccgtgggct
gctcccagccagggtggagcgcccgggatgttccccggcagtgccttggcgacacggaag
ccacccagagactccatgtgcgcgttcctgccgtag

DBGET integrated database retrieval system