KEGG   Camelus ferus (Wild Bactrian camel): 102504882Help
Entry
102504882         CDS       T02979                                 

Gene name
DNASE2B
Definition
(RefSeq) deoxyribonuclease 2 beta
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102504882 (DNASE2B)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     102504882 (DNASE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II NAR2
Motif
Other DBs
NCBI-GeneID: 102504882
NCBI-ProteinID: XP_006190237
Position
Un
AA seq 357 aa AA seqDB search
MTTRLLRKTLALFFLGLFGVMKATTISCRNEEGEAVDWFTFYKLPKRQDKKSRETGLEYL
YLDSTSRGWRRSQQLMNTTKSVLGRTLQQLYEAYASENNNTAYLIYNDGVPKSVTHGRKY
GHTKGLLLWNRVQGFWLIHSIPQFPPVPEEGYDYPPTGRRNGQAGICITFEYRQYEAIDS
QLLVCNPNVYSCSIPVTFHQDLVHIPQLCARSSSAKMPTRHLATLQSTQGQNFLHFAKSD
SFLDDIFAAWMAQRLKTHLLTETWQRKRQKLPSNCSLPYHVYNIKAIKISRHSYFSSYQD
HAKWCTSQKGTKNRWTCIGDLNRSPSQAFRSGGFICTQNQHIYQAFQRLILYYENCN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaagacttctgagaaaaaccctggctttgttcttccttggcctctttggggtc
atgaaggcgacaacaatatcgtgcagaaatgaagaaggtgaagctgtggattggtttacc
ttttataagttacctaaaaggcaagacaagaaaagtagagagactgggttagagtaccta
tacctagactctaccagcagaggctggaggaggagtcagcagctaatgaacaccaccaag
agtgttttgggaaggaccttacaacagctgtatgaagcatatgcctccgagaataacaac
acagcctatctaatatacaacgatggagtccctaaatctgtgactcacggcagaaagtac
ggacacaccaaaggtttattgctgtggaacagagtccaggggttctggctgattcattcc
attccccagtttcctccagttcctgaagaaggctacgattacccacccacggggagacgg
aacggacaagccggcatctgcatcactttcgagtaccgccagtatgaagcaatagattct
cagctcttggtctgcaacccaaatgtttacagctgttccatcccagtcacctttcaccag
gacctcgttcacataccccagctgtgtgccaggtccagctcagcaaagatgcctacccgt
caccttgccacacttcagtcaacccaggggcaaaacttccttcattttgcaaagtctgat
tcttttcttgatgacatctttgctgcctggatggctcaacgcttgaagacacacttgcta
acagaaacctggcagcgaaagagacaaaagcttccttcaaactgctcccttccttaccat
gtctacaacatcaaagcaattaagatatctagacactcatattttagttcctatcaggat
catgccaaatggtgtacttcccaaaagggtacaaaaaatcgctggacatgtattggagac
ctcaatcggagcccatcccaagccttcagaagtggaggattcatctgtacccagaatcag
catatttaccaagcatttcaaagattaattttgtattatgagaactgtaactaa

DBGET integrated database retrieval system