KEGG   Camelus ferus (Wild Bactrian camel): 102505123Help
Entry
102505123         CDS       T02979                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00480  Glutathione metabolism
cfr00590  Arachidonic acid metabolism
cfr01100  Metabolic pathways
cfr04918  Thyroid hormone synthesis
cfr05014  Amyotrophic lateral sclerosis (ALS)
cfr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102505123 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102505123 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102505123 (GPX8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    102505123 (GPX8)
   05016 Huntington disease
    102505123 (GPX8)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102505123 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 102505123
NCBI-ProteinID: XP_006185992
Position
Un
AA seq 209 aa AA seqDB search
MEPLTAYPLRCSGPKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDAKGRTV
SLEKFRGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGDSEPRPSK
EVVTFARNNYGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPKWNFWKYLVNPEGQVVKS
WRPEEPIEVIRPEIAALIRQMIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcacagcctaccctttgagatgttcagggcccaaagcaaaggtatttgca
gttttgctgtctatggttctatgtacagtaatgctatttcttctacaactaaaattccta
aaacctaaaatcaacagcttttataccttcgaagtgaaagatgcaaaaggaagaacggtt
tctctggaaaagtttagaggcaaagttgcactagttgtaaacgtggctagtgactgccaa
ctcacagacagaaattacttagcactgcaggaactacacaaagagtttggaccattccac
ttcagcgtcttggcttttccttgcaatcagtttggagactcggagccccgcccaagcaag
gaagtagtaacttttgcaagaaataactacggagtaacattccccatcttccacaagatt
aagattctaggatcggaagcagaacctgcattcagatttcttgttgattcttcgaagaag
gaaccaaagtggaatttttggaagtatctggtcaaccccgagggtcaagttgtgaagtcc
tggaggccagaggaacccattgaagtcatcaggcctgagatagcagctctgattagacaa
atgatcataaaaaagaaagaggatctatga

DBGET integrated database retrieval system