KEGG   Camelus ferus (Wild Bactrian camel): 102506579Help
Entry
102506579         CDS       T02979                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04020  Calcium signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04925  Aldosterone synthesis and secretion
cfr05214  Glioma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102506579 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102506579 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    102506579 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102506579 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102506579 (CAMK1D)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102506579 (CAMK1D)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102506579 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Tyrosinase Pox_ser-thr_kin APH
Motif
Other DBs
NCBI-GeneID: 102506579
NCBI-ProteinID: XP_006174255
Position
Un
AA seq 288 aa AA seqDB search
MQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDE
ESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCG
YPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHP
WIAGDTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNAGVSS
SLSLASQKDCLAPSTLCSFISSSSGVSGVGADRRPRPTTVTTVHSGSK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggtgtctggtggagagctgtttgaccggatagtggagaagggattttacaca
gagaaagatgccagcactctgatccgccaggtcttagacgctgtctactatctccataga
atgggcattgttcacagggacctcaagcctgagaaccttttgtactacagtcaagatgag
gagtccaaaataatgatcagtgactttggattgtccaaaatggagggcaaaggcgacgtg
atgtccaccgcatgtgggaccccaggctatgtcgctccggaggtcctggcccagaaaccc
tacagcaaagccgttgactgctggtccatcggggtgatcgcctacatcttgctctgcggt
taccctcctttttatgacgagaatgactccaagctctttgagcagatcctcaaggcggaa
tatgagttcgactccccctactgggatgacatctctgactccgcaaaggacttcattcgg
aatctgatggagaaggatccaaataaaagatacacatgcgagcaggcagctcggcaccca
tggatcgccggtgacacagctctcagcaaaaacatccacgagtccgtcagcgcccagatc
cggaagaacttcgccaaaagcaagtggagacaagcgtttaatgccacggccgtcgtgaga
catatgagaaaactccatctcggcagcagcctggacagttccaacgcaggtgtttcgagc
agcctcagtttggccagccaaaaagactgcctggcaccctccacgctctgtagtttcatt
tcctcttcgtcgggggtctcaggagtgggagcagatcggagaccgaggcccaccactgtg
acgacggtgcactctggaagcaagtga

DBGET integrated database retrieval system