KEGG   Camelus ferus (Wild Bactrian camel): 102506786
Entry
102506786         CDS       T02979                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X3
  KO
K04829  acid-sensing ion channel 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102506786 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfr04040]
    102506786 (ASIC1)
Ion channels [BR:cfr04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102506786 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102506786
NCBI-ProteinID: XP_006177765
Position
12
AA seq 558 aa
MPIQIFCSVSFSSGEEVPGPLGDVWSPHQRQQRDNSESEEEEEKEKETERKEFGKGDSPT
DLVAFANSCTLHGASHVFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVTL
LDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFS
GEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSITACRIDCETRYLVENCNCRMVHM
PGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYL
AKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV
LELFDYAYEVIKHKLCRRGKCQKEAKRTSTDKGVALSLDDVKRHNPCESLRGHPAGMTYA
ANILPHHPARGTFEDFTC
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcccatccagatattctgttctgtgtcattctcctctggagaggaggtcccggggccc
ttgggagatgtttggagtccccaccagcggcaacagcgggacaactcagagtcagaagag
gaagaagagaaggaaaaggagacagagaggaaggagtttggaaagggggattcaccgacg
gacttagtggccttcgccaatagctgcaccctccatggcgccagccacgtctttgtggag
gggggtccagggccgcggcaggccctgtgggcagtggcctttgtcctggcactgggcgcc
ttcctgtgtcaggtaggggatcgagttgcctattacctcagctacccacatgtgactctg
ctagacgaagtggccaccacggagctggccttcccggcggtcaccctctgcaacaccaat
gctgtgcggctgtcccagctcagctaccctgacttgctctacctggcccccatgctgggg
ctggatgaaagtgatgaccccggggtgccccttgccccgccggggcccgaggccttctct
ggggagcccttcaacctgcaccgcttctacaatcgctcctgccaccggctggaggacatg
ctgctctattgctcctactgcggggggccctgtggccctcacaacttctcagtggtcttc
acacggtatggaaaatgctacacgttcaactctggccgagatgggcgtccacggctgaag
acgatgaagggtgggacaggcaatgggctggaaatcatgctggacatccagcaggatgaa
tacctgcccgtatggggggagaccgatgagacgtcattcgaagcaggcatcaaagtgcag
atccacagtcaggatgaacctcccttcattgaccagctgggctttggcgtagccccaggg
ttccagacctttgtggcctgccaagagcagcggctcatctacctgcccccgccctggggc
acctgcaaagctgttaccatggacttggatttcttcgactcctacagcattaccgcctgc
cgcattgactgtgagacacgttacctggtggagaactgtaactgtcgcatggtgcacatg
ccaggggatgccccatactgcactccagagcagtacaaggagtgtgcagatcctgctcta
gacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacttgacc
cgttatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtacctg
gccaagaagttcaacaaatctgagcagtacataggggagaacatcctggtactggacatt
ttctttgaagtcctcaactatgagaccattgagcagaagaaagcctatgagattgcaggg
ctcctgggtgacattgggggccagatggggctgttcatcggggccagcatcctcacggtg
ctggagctctttgactatgcttacgaggtcattaaacacaagctgtgcagacgagggaag
tgccagaaggaggccaaaaggaccagcacggacaagggcgtggccctcagcctggatgac
gtcaaaagacacaacccgtgtgagagcctccggggccatcctgccgggatgacgtatgct
gccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system