KEGG   Camelus ferus (Wild Bactrian camel): 102507142Help
Entry
102507142         CDS       T02979                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00564  Glycerophospholipid metabolism
cfr00565  Ether lipid metabolism
cfr00590  Arachidonic acid metabolism
cfr00591  Linoleic acid metabolism
cfr00592  alpha-Linolenic acid metabolism
cfr01100  Metabolic pathways
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04217  Necroptosis
cfr04270  Vascular smooth muscle contraction
cfr04370  VEGF signaling pathway
cfr04611  Platelet activation
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04724  Glutamatergic synapse
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04912  GnRH signaling pathway
cfr04913  Ovarian steroidogenesis
cfr04921  Oxytocin signaling pathway
cfr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102507142 (PLA2G4D)
   00565 Ether lipid metabolism
    102507142 (PLA2G4D)
   00590 Arachidonic acid metabolism
    102507142 (PLA2G4D)
   00591 Linoleic acid metabolism
    102507142 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    102507142 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102507142 (PLA2G4D)
   04010 MAPK signaling pathway
    102507142 (PLA2G4D)
   04370 VEGF signaling pathway
    102507142 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    102507142 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102507142 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102507142 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    102507142 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    102507142 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102507142 (PLA2G4D)
   04913 Ovarian steroidogenesis
    102507142 (PLA2G4D)
   04921 Oxytocin signaling pathway
    102507142 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102507142 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    102507142 (PLA2G4D)
   04726 Serotonergic synapse
    102507142 (PLA2G4D)
   04730 Long-term depression
    102507142 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102507142 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102507142 (PLA2G4D)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102507142 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 102507142
NCBI-ProteinID: XP_006178959
Position
Un
AA seq 817 aa AA seqDB search
MERPTPRGPPGHPHQGEASVCWRLTVRVLEARGLGWADLLSEADPYVTLQLLTAPGMKFR
TKTVTNSSHPVWNETFTFLIQRQVKNVLELSVCDKDSVTEDDVCFKVLYDISEVLPGRLL
RKTFSPHPQGQEELDMEFLMERMSDCPENLITNNVLVARELSCLDVRLDNTGSTAVAADQ
DKLELELVLKGSYEDTQTSTLGTASAFRFHYMAAQEAELSGCLRSSKTKGWNSGNSTGHL
TVPLMSLAMGKEVTVDIPATSAPGVKLQLKAESCPKELAVHLGFDLCAKEKAFLSKRKQV
VAKALKQVLRLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLKGPIRYAREHLAKSKLEAFSPERLASYYRELELQAKQGH
PTTFVDLWGLVLEFMLHGQVMDQKLSGQRAALEQGQNPLPLYLSLNVKENNLQTLDFKEW
VEFSPYEVGFLKYGAFVPSELFGSEFFMGRLMRRIPESRICFLEGIWSNIFSLNLLDAWY
DFTSTGDSWKQHIKDKIRNLEEPPASSDTSSRSEALWLQPGTALAQMFKGILTGRPLCQH
SSNFLQGLQLHQDYCAQKDFSTWADCQLDSSPGQLTPQEPQLCLVDAGYFINTSCPAMFR
PGRRLDLILSFDYSLSSPFAVLQETELDCRARGLPFPRVEPSPEDLHQPRECHVFSDPAC
PDAPVLLHFPLVNASFKDHSAPGVQRSPAELPAGQVDLAGVTSPYSMFNMTYKEEDFDRL
LQLSDYNVCNSQNTILQALRTALKHRAPGTRPPGAQT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggagagaccgacacctaggggaccacctggccatcctcaccagggggaggcctctgtc
tgctggcggctcacagtgagggtcctggaggcacggggcctgggctgggctgacctgttg
agcgaggcagacccctatgtgacgcttcagttgctaactgcacctggaatgaagtttagg
accaaaacagtcaccaactccagtcatcctgtgtggaatgagaccttcacgttcctgatc
cagaggcaggtcaagaatgttctggagctgagtgtctgtgacaaggactcagtcacagag
gacgatgtctgcttcaaggttctctatgacatctccgaagtcctccctggcaggctgctc
cggaagacattctccccgcatccccagggacaggaagagctggatatggagttcctgatg
gagagaatgtcagactgcccagaaaacctcatcaccaacaatgtgcttgtggcccgagag
ctgtcatgcctagatgtccgtctagacaacacagggagcaccgccgtggctgcagatcag
gacaagctggagctggagctggtgctgaaggggtcatatgaagacacacagacctccacc
ctgggcacagcctctgccttccgcttccactacatggcagcccaagaggcagagctaagc
gggtgcctgaggagctccaaaaccaagggctggaactcaggtaactccactgggcacctc
actgtgcccctgatgtccttggccatggggaaggaggtgaccgttgacattcctgctaca
agtgccccaggagtgaagctgcagctcaaagctgagagctgccccaaggagcttgctgtg
catctgggctttgatctgtgtgccaaggagaaagctttcctgagcaagaggaagcaggtg
gtggccaaggccctgaagcaggtcttgcggctggacagagacctacaggaggatgaggtc
cctgttgtgggcatcatggccacaggaggaggtgctcgggccatgacctctctctacggc
cacctattggccctgcagaagctgggccttctggactgtgtgacctacttcagtggcatc
tcgggctctacatggactatggcccatctgtatggggaccctgagtggtcgcagagggac
ctcaagggacccatcaggtatgcccgggagcacctggccaagagcaagctggaggccttc
tctcctgagcgcctggcgagctactaccgggagctggagctgcaggccaagcagggccac
cccacgacctttgtggacctgtggggtctggtgctggagttcatgctccacggtcaggtg
atggatcagaagctgtcaggacagagagccgcactggagcagggccagaaccctctgccc
ctctacctgagcctcaatgtcaaagagaacaatctgcagaccctcgacttcaaggagtgg
gtcgagttctccccctatgaggttgggttcctgaagtatggagcctttgtaccttctgag
ctctttggctccgagttcttcatggggcggctgatgaggaggatccctgagtcccggatc
tgctttctggaaggtatctggagcaacattttctccctgaacttgctggatgcctggtat
gacttcaccagcaccggagactcctggaagcagcacatcaaggacaagatcaggaacctg
gaggagccccctgcctcctcggacacctcctcaaggtcagaggccttgtggctgcagcct
ggaacagcgctagcccagatgtttaagggcatcctgacgggcagaccactctgccagcac
agctccaacttcctccagggcctccagctgcaccaggactactgtgcccagaaagacttc
tccacctgggcagactgccagctagactcctcccccggccagctgaccccgcaggagcct
cagctctgcctggtggatgctggctacttcatcaacaccagctgtcctgccatgttccgg
ccaggccgcaggctggacctcatactttccttcgattattccctatcctcgccctttgcg
gtgctgcaggagactgagctggactgccgggccagggggctgccgttcccccgtgtggag
cccagccctgaggacctgcaccagccccgggagtgccatgtcttctcagaccctgcctgc
cccgacgcccctgtcctgctgcacttcccgttggtcaatgcctccttcaaggaccactca
gcccccggtgtccagcgcagccctgcagagctcccggctggccaagtggatctcgcgggg
gtcacctccccctattccatgttcaacatgacttacaaggaggaagactttgaccgcctg
ctgcagctcagtgactacaatgtctgcaacagccagaacaccatcctgcaggctttgagg
actgctctcaagcaccgggccccggggaccaggcctccaggggcacaaacttga

DBGET integrated database retrieval system