KEGG   Camelus ferus (Wild Bactrian camel): 102507254Help
Entry
102507254         CDS       T02979                                 

Gene name
NTRK2
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102507254 (NTRK2)
   04010 MAPK signaling pathway
    102507254 (NTRK2)
   04151 PI3K-Akt signaling pathway
    102507254 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102507254 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    102507254 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102507254 (NTRK2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102507254 (NTRK2)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   102507254 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Haspin_kinase Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 102507254
NCBI-ProteinID: XP_006183241
Position
Un
AA seq 838 aa AA seqDB search
MSSWTRWHGPAMARFWGFCWLIIGFWRAALACPTSCKCSASRIWCSDPSPGIVTFPRLEP
TSADPENITEIYIANQKRLEIISEDDVEAYVGLKNLTIVDSGLKFVAPKAFLKNSNLQHI
NFTRNKLAILSRKHFRHLDLSELVLVGNPFTCSCDIMWIKTLQEIKTSPETQDLYCLDEN
SRNISLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNLYWDVGNLVSKHM
NETSYTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVADKPGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRRNIKGIHTLLQNLAKASPVYLDILG
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggacgaggtggcatgggccagccatggcgcggttctggggcttctgctgg
ctgatcataggcttctggagggccgctctcgcctgtcccacatcctgcaaatgcagcgcc
tctcggatctggtgtagcgacccttctcctggcatcgtgacatttccgaggttggagcct
accagtgcggaccctgagaacatcactgaaatttacattgcaaatcagaagagattagaa
atcatcagtgaagatgatgtggaagcttatgtgggactgaaaaatctgaccattgtggat
tctggattaaaatttgtggctcctaaagcatttctgaaaaacagcaacttacagcacatc
aattttacccgaaataaactggcaattttgtctcggaaacattttcgtcacctcgacttg
tctgaactggtcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actcttcaggagattaaaaccagtccagaaactcaggatttgtactgtctcgatgaaaac
agcaggaatatttcactggcaaacctgcagatacccaattgtggtttgccgtcagcaaat
ttggccgcgcctaacctcactgtggaggagggaaagtctatcacattgtcttgtagtgtt
gcaggcgatccagttccgaatttgtactgggatgtcggtaatctggtttccaagcatatg
aatgaaacaagctacacacagggctccttaaggataactaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggcagaaaatcttgtaggagaagatcaagattcggtcaac
ctcactgtacattttgctccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaattttgaatgagtccaaatacatctgtactaaaatccatgtcaccaatcacacg
gagtaccacggctgcctccagctggataaccccacccacatgaacaatggggactacaag
ttagtagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaatcgatgatggtgcaaacccaaattatcctgatgtcatttatgaagactat
gggactgcagccaatgacatcggggacaccacgaacagaagtaatgaaattccttccaca
gatgtcgctgacaaacctggtcgggaacatctctcggtctatgctgtggtggtaattgca
tctgtagtgggattttgtctgctggtaatgctgtttctgctgaagttggcaagacattcc
aagtttggcatgaaagatttctcatggtttggatttgggaaagtaaaatcaagacaaggt
gttggcccagcctcggttatcagcaatgatgatgactctgccagcccgctccatcacatc
tccaatgggagtaacaccccgtcgtcttcagagggcggccctgatgccgtcattattgga
atgaccaagattcctgttattgaaaatccccagtactttggcatcaccaacagtcagctc
aagccagacacatttgttcagcacatcaagagacataacattgttctgaaaagggagcta
ggcgaaggagcctttggaaaagttttcctagctgaatgctataacctctgtcctgagcag
gacaagatcttggtggcagtgaagacactgaaggacgccagcgacaatgcacgcaaggac
ttccaccgcgaggccgagctactgaccaacctccagcacgagcacatcgtcaagttctac
ggtgtctgcgtggagggcgacccgctcatcatggtcttcgagtacatgaagcacggagac
ctcaacaagttcctcagggcacacggacctgacgccgtgctgatggccgaaggcaaccct
ccgacggagctgacgcagtcgcagatgctgcacatcgcccagcagatagccgcgggcatg
gtctacctggcgtcccagcacttcgtgcaccgagacctggccactcggaactgcctggtc
ggcgagaacctcctggtgaaaatcggggacttcggcatgtcccgggacgtgtacagcacc
gactactaccgggtgggcggccacacgatgctgcccatccgctggatgcctccggagagc
atcatgtaccggaagttcaccaccgagagcgacgtctggagcctgggggtcgtgctgtgg
gagatcttcacgtacggcaaacagccctggtaccagctgtccaacaacgaggtgatagaa
tgcatcactcagggccgagtcttgcagcgaccccgaacgtgcccccaggaggtctacgag
ctgatgctggggtgctggcagcgggagccccacatgaggaggaacatcaaaggcattcac
accctcctgcagaacttggccaaggcgtccccggtctacctggacatcctcggctag

DBGET integrated database retrieval system