KEGG   Camelus ferus (Wild Bactrian camel): 102507858Help
Entry
102507858         CDS       T02979                                 

Gene name
FKBP5
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP5 isoform X1
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102507858 (FKBP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfr03110]
    102507858 (FKBP5)
Enzymes [BR:cfr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102507858 (FKBP5)
Chaperones and folding catalysts [BR:cfr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102507858 (FKBP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_6 TPR_19 TPR_12 TPR_7 Fis1_TPR_C TPR_11 TPR_9 ANAPC3 PknG_TPR TPR_16
Motif
Other DBs
NCBI-GeneID: 102507858
NCBI-ProteinID: XP_032318797
Position
20
AA seq 457 aa AA seqDB search
MTTDEGAKNNGENPAAAVAEQGEDITSKKDRGVLKLIRRVGNSEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRIKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVGFIVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKNFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEASKAMGKKNSEGVTDEKETESQSMEEEKAEGHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgactactgatgaaggtgccaagaacaatggagaaaacccagcagcagctgttgctgaa
cagggagaggatattacctccaaaaaagatagaggagtattaaagcttatcagaagagtg
gggaatagtgaggaaacaccaatgattggagacaaagtttatgtccattacaaaggaaaa
ttgtcaaatgggaagaagtttgattccagtcatgatagaaacgaaccatttgtctttagt
cttggcaaaggccaggttatcaaggcatgggacattggtgtggctaccatgaagaaagga
gagatctgccatttactctgcaaaccagaatatgcatatggctctgctggcagtctcccc
aaaattccctcgaatgcaactctcttttttgagattgagctccttgatttcaaaggagag
gatttatttgaagatggaggtattatccgaagaattaaacggaaaggagaagggtattca
aacccaaacgaaggagcgacggtagaaatccacctggaaggccgctgtggaggaaggatg
tttgattgcagagatgtagggttcatcgttggtgaaggagaagaccacgacattccaatt
ggaattgacaaagctctggagaaaatgcagcgtgaggaacaatgtattttatatcttgga
ccacgatacggttttggagaggcagggaagcctaaatttggcattgaacctaatgctgaa
cttatatatgaagttacacttaagaacttcgaaaaggccaaagaatcctgggaaatggat
accaaagaaaaattggaacaggctgccattgtcaaagagaagggaactgtgtacttcaag
ggaggcaagtacatgcaggcggtgattcagtatgggaagatagtgtcctggttagagatg
gaatatggcttatcggagaaggaatctaaagcctctgaatcgtttctgctcgctgccttc
ctgaacctggccatgtgctacctgaagctcagagagtacaccaaagccgtcgagtgctgt
gacaaggcccttggactggacagtgccaatgagaagggcttgtacaggaggggcgaagcc
cagctgctcatgaacgagtttgagtcagccaagggcgactttgagaaagtgttggaagta
aacccccaaaataaggccgcaagactgcagatctccatgtgccagaaaaaagccaaggag
cacaatgagcgggaccgcaggatatatgccaacatgttcaagaagtttgcagagcaagat
gcaaaggaagaggccagtaaagcaatgggcaagaagaattcagaaggggtcaccgatgaa
aaagaaacagaaagtcaatcaatggaagaagagaaagctgagggccacgtatga

DBGET integrated database retrieval system