KEGG   Camelus ferus (Wild Bactrian camel): 102508382Help
Entry
102508382         CDS       T02979                                 

Definition
(RefSeq) 17-beta-hydroxysteroid dehydrogenase type 6
  KO
K13369  17beta-estradiol 17-dehydrogenase / all-trans-retinol dehydrogenase (NAD+) / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.105 1.1.1.239]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00140  Steroid hormone biosynthesis
cfr00830  Retinol metabolism
cfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102508382
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102508382
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     102508382
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     102508382
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     102508382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 102508382
NCBI-ProteinID: XP_006186057
UniProt: S9WNJ6
Position
Un
AA seq 191 aa AA seqDB search
MWLYLAALVGLYHLLRWYRERQVVSHLRDKYVFITGCDSGFGNLLARQLDLRGLRVLAAC
LTEKGAQKLKGQTSDRVETVILDVTNTQSIAAATQWVKERVGDRGLWGLVNNAGTFHPFG
YTDWLKIDTYMSTLQVNLIGLIEVTLSMLPLVKSAQGRIVNVSSIPGRLALFGTVYCCSN
YGVEAFSDVLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtacctggcggccctggtgggcctgtaccacctcctgcgctggtaccgggag
aggcaggtggtgagccacctccgggacaagtacgtcttcatcacgggctgtgactcgggc
ttcgggaacctgctggccaggcagctggacctgcgaggactcagggtgctggctgcgtgt
ctgaccgagaagggggcccagaagctgaagggccagacgtcagatagggtggagacggtg
atcctggatgtcaccaacacacagagcatcgctgcggccacccagtgggtgaaagagcgt
gtgggggacagaggactttggggtctggtcaacaacgcaggcacttttcacccatttggc
tacactgactggctgaagattgacacctacatgagtaccctccaagtcaacctcattggt
ttgatagaggtgaccttgagcatgcttcccttggtgaagagcgcacaggggagaatcgtc
aatgtctccagcattccgggaagacttgctctctttggaacagtctactgttgctccaat
tatggagtggaagccttttcagatgttctgaggtaa

DBGET integrated database retrieval system