KEGG   Camelus ferus (Wild Bactrian camel): 102508937Help
Entry
102508937         CDS       T02979                                 

Gene name
FKBP8
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP8 isoform X1
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102508937 (FKBP8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfr03110]
    102508937 (FKBP8)
Enzymes [BR:cfr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102508937 (FKBP8)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102508937 (FKBP8)
Chaperones and folding catalysts [BR:cfr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102508937 (FKBP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_14 Fis1_TPR_C TPR_16 TPR_9 TPR_11 TPR_8 TPR_7 TPR_19 TPR_12 ANAPC3 TPR_17 TPR_6 TPR_20 NARP1
Motif
Other DBs
NCBI-GeneID: 102508937
NCBI-ProteinID: XP_032321121
UniProt: S9WN37
Position
22
AA seq 411 aa AA seqDB search
MASCAEPSAVGPEPIAPPPAGVPPLEDFEVLDGVEDAEGEEEEEEDLSELPPLEDVGQPP
VEEAEQPGALAREFLASMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGPPGSSRPAKGQV
VTVQLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQ
GSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAA
NSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEH
QPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTET
ALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctgtgctgagccctctgctgtgggccctgagcccattgccccgccacctgct
ggggtcccaccacttgaggacttcgaggtactggacggggtggaagacgcagagggcgag
gaggaggaagaggaggacctgagtgagctaccgccacttgaggatgtggggcagccccca
gtggaggaggccgaacagcctggggccttggcccgagagttcctggcctccatggagcct
gagcctgagccggccccggccccggacgagtggctggacatcttggggaacgggctattg
aggaagaagacgctggttccagggccaccaggctcaagccgcccggccaagggccaggtg
gtcactgtgcagctgcagacatcgctggagaatggcacgcgggtacaggaggagccagag
ctggtgttcaccctgggcgactgtgacgtcatccaggccctggatctcagtgtcccgctc
atggacgtgggggagacggctatggtcactgctgactccaagtactgctatggcccccag
ggcagcaggagcccgtacatccccccacacgcggccctgtgcctggaggtgaccctgaag
actgccgtggatgggcctgacctagagatgctcacggggcaggagcgtgtggccctggcc
aaccggaagcgggagtgtggcaatgctcactaccagcgggccgactttgtgctggctgcc
aactcctacgacctcgccatcaaggccatcacctctagcgccaaagtggacatgacattt
gaggaggaggagcagctcctgcagctgaaggtgaagtgtctgaacaacttggcagcctca
cagctgaagctggatcactaccgtgcagcactgcgctcctgcagccttgtgctcgagcac
cagcccgacaacatcaaggcgctcttccgcaagggcaaggtgctggcccagcaaggcgag
tacagtgaggccatccccatcctgagggcagccctgaagctggaaccttccaacaagacg
atccacgcagagctctcgaagctggtgaagaagcatgcggcccagcggagcacggagacc
gccctgtaccggaagatgttaggcaaccccagccggctgcctgccaaatgtcctggcaag
ggtgcctggtccatcccatggaagtggctgtttggggcaactgcggtcgccttggggggt
gtggctctctctgtggtcatcgctgccaggaactga

DBGET integrated database retrieval system