KEGG   Camelus ferus (Wild Bactrian camel): 102509949
Entry
102509949         CDS       T02979                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfr03021]
    102509949 (AFF3)
Transcription machinery [BR:cfr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102509949 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int MACPF
Other DBs
NCBI-GeneID: 102509949
NCBI-ProteinID: XP_032325619
Position
28
AA seq 1274 aa
MGPRVAVPTGAPCVPLFRARGSKPGERAAGGALRVLLLQGFTLRSCCSVYEPDRNVLRRK
ERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQT
HLVGVPKPGVPPAPVNKIDEHFVADSRAQPQPASVCSTASSSPAAVPGQQSKRATVGWQK
AGHQPSDGQQRATTQGSLRTLLGDGVGRQQPRTKQVCNVEVGLQTQERPPAMAAKHGSGG
HCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETSVHCPSHRGAPAA
KPESARAKAKLAKFSIPKQGEENRSGETNSCVEEIIREMTWLPPLSAVQAPGKVEQSKFP
FPNKDSQLVSSGHNNPKKGGAEPGSPDNGTSNTSSLGWLSPFTDQGNDAVRGMLEDDLKL
SSDEEENEQAAQRTALHALSDSAGAQQASGRASAPSSKGSSSGSSSSGSSSSSDSESSSG
SDSETESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPES
NQYYTAAKDEAPDCGKLPEVCPPSLREKDIKSACKEEQRPRTANKAPGSKGVKQKSPPAA
AAVALPAAAPPPAGPGAPAESAPAPARRSAGKKPTRRTERTSAGDGAGGHRPEEPAAPDA
LGASAGLPPEPPKPRPCGNSRTSHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSS
SSSSDSDLESEQEDYPLSKAQAVAAAAAAAGSDQRLKEAANSVGSGGPRAPVGSINARTT
SDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRVPEHLPQEPGVLSA
PAAKDSESAPLSHASDAPAEKALPKSKRKRKCDNEDDYREVKKAQGEKESSSRLTASANG
TLSANHCNVSISSLAIPINKNEKMLRSPISPASDASKHKYSGEDFTSCGRPGSNGLLTSA
SASKKHKPESQLPTHAGDVTKAAHNASENVLHKSRPQTEPWSPGSNGHRDCKRQKLVFDD
MPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMY
SETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALID
YFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPTNSVGSQGSLSNASTLSPSTIVSIPQ
RIHQMAANHVSITNSILHSYDYWEMADSLAKENREFFNDLDLLMGPVTLHSSMEHLVQYS
QQGLHWLRNSAHLS
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgggacctcgagtcgctgtgcccaccggcgccccgtgtgtccctttattccgcgctcga
ggctcgaagccgggggagcgggcggccgggggagcactccgggttctgctgctccagggt
ttcacactgaggagctgctgtagcgtctatgaaccagatagaaacgtgttacggaggaaa
gaacgagaaagaagaaatcaggaaactcaacaggatgatggcacgtttaattcgagttac
tccctcttcagtgaaccctacaagactaacaagggggatgagctctccaaccggatccag
aacacgttgggcaattatgatgagatgaaagactttttaacggatagatccaatcagact
cacctcgtgggtgttcccaagcctggggtccctccggctcccgtgaacaagattgacgag
catttcgttgcagattcgagggcccagccccagcccgcatccgtctgtagcacggcgtcc
tcctcgccggcagctgtccccgggcagcagagcaagcgggccaccgtgggctggcagaag
gctggccaccagccctccgacggccagcagagagcaacaacacagggctctctcaggacc
ttgctcggagatggtgtcggcagacagcagccacggaccaagcaggtgtgcaatgttgag
gtgggtcttcagacccaggaaaggcccccagctatggcagccaagcacggcagcggcgga
cactgtgttcagaactttcctccatccctggcttcgaaacctagcctggtccagcagaaa
cccaccgcctacgtgcggccaatggacggccaggaccaggctcccgatgagtctccgaag
cttaaatcatccacagaaaccagcgtgcactgcccatcacaccggggagccccagctgcc
aagccagagtctgccagagccaaggccaagcttgccaagttcagcatccccaaacaggga
gaggagaatagatctggagaaaccaacagctgtgttgaagaaatcattcgggagatgacc
tggcttcccccactctctgctgttcaagcacctggcaaagtggaacaaagcaaatttcca
tttccaaataaggactctcagctcgtttcctcgggacacaataatccaaagaaaggtggt
gctgagccagggagtccggacaatggcacgtcgaatacatcctctctgggatggttatcc
ccatttacagatcagggaaatgatgcagtgagaggaatgctagaagatgaccttaagcta
agtagtgatgaagaggagaatgaacaggcagcccagagaacggctctccacgctctgtct
gacagcgccggggcccagcaggccagcggcagggcctccgcgccttccagcaagggtagc
agcagcggcagcagcagcagcgggagcagctcctccagcgactcggagagcagctcgggg
tccgactcggagaccgagagcagttccagcgagagtgagggcagcaagcccccccactac
tccagccccgaggccgaaccagcgtcctccaacaagtggcagctggataaatggctaaac
aaagttaatccccacaagcctcctattctgatccaaaacgaaagccacgggccggagagc
aaccagtactacaccgcggcgaaggacgaagcgcccgactgtgggaagcttcccgaagtc
tgcccgcccagcctgagggagaaggacatcaagagcgcctgcaaggaggagcagcggccg
aggaccgcgaacaaggccccagggagcaaaggcgtgaagcagaagtccccgcccgcggcc
gcggccgtggccctgcccgccgccgcgccgcctcccgcggggcccggggcgcccgccgag
agcgcgcctgcgcccgcccggaggtccgcgggcaagaagcccacccggcgcaccgagagg
acctcggccggcgacggcgccggcggccaccggcccgaggagcccgccgcccccgacgcg
ctgggcgccagcgcggggctcccccccgagccccccaagcccaggccctgcggcaacagc
aggacgagccaccgcaaggagctgcgctcgtccgtgacctgcgagaagcgccgcacgcgg
gggctgagccggatcgtccccaaatccaaggagttcatcgagaccgagtcgtcatcgtcg
tcctcctcctcggactcggacctggagtcggagcaggaggactaccctctgtccaaggcg
caggccgtggccgccgccgccgccgccgccgggagcgaccagaggctcaaggaggccgcc
aacagcgtcggcagcggcggcccccgcgcccccgtgggctccatcaacgccaggaccacc
agcgacatcgccaaggagctggaggagcagttctacacgctggtccccttcggccgcaac
gaacttctctcccccttgaaggacagtgacgaggtcaggtctctctgggtcaaaattgac
ctgaccctcctgtccagggtcccagaacacctgccccaagagccgggggtcttgagcgct
cctgcggccaaggactctgagagcgccccgctgagccacgcatcagacgcgccagcagaa
aaggctttgccaaaatccaagaggaaacgcaagtgtgacaacgaagacgactacagggag
gtcaagaaggcccagggagagaaggagagctcttcacgactgactgcctctgccaacggt
actttgtctgcaaaccactgcaacgtgagcatcagcagcttggcaataccaataaacaaa
aatgaaaaaatgctgcggtcgcccatctcccccgcatccgacgcgtctaaacacaaatac
tcaggtgaggacttcacctcctgcggccgacccggcagcaatggcttgcttacctccgcc
tccgccagcaagaagcataagccggagagccagctgccgacccacgccggggacgtcacg
aaagcggctcacaacgcttccgagaacgttctccacaagtcacggccacagacagagccg
tggtctccaggctccaacggccacagggactgcaagaggcagaaacttgtcttcgacgac
atgccacgcagtgcagattattttatgcaagaagctaaacgaatgaagcataaagcagat
gcgatggtggaaaagtttggaaaggctctgaactacgcagaagcagccttgtcgttcatc
gagtgcggaaatgccatggagcaaggccccatggaatccaagtctccctacacgatgtac
tcagagacggtggagctcatcaggtatgctatgagactaaaaacccactcaggccccaac
gccacaccagaggataaacagttggctgcattgtgttaccgatgcctggccctcctgtac
tggcggatgtttcgactcaaaagggatcacgctgtaaagtattccaaagcacttatcgac
tattttaagaattcatctaaagctgcccaagccccgtctccgtggggggccagtggaaag
agcacgggaactccatcccccatgtctcccaacccctcgcccaccaactccgtgggatct
caggggagcctctccaacgccagcaccctgtccccctcaaccatcgtcagcatcccacag
cgcatccaccagatggccgccaatcacgtcagcatcaccaacagcatcctccacagctac
gactactgggagatggcagacagcctggccaaggagaacagagaattcttcaacgacctg
gacctgctcatggggccggtcaccctgcacagcagcatggagcacctggtccagtactcc
cagcagggcctgcactggctgcggaacagcgcccacctgtcgtag

DBGET integrated database retrieval system