KEGG   Camelus ferus (Wild Bactrian camel): 102513537Help
Entry
102513537         CDS       T02979                                 

Gene name
TRMT1
Definition
(RefSeq) tRNA methyltransferase 1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfr03016]
    102513537 (TRMT1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     102513537 (TRMT1)
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     102513537 (TRMT1)
Transfer RNA biogenesis [BR:cfr03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    102513537 (TRMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRM zf-CCCH Met_10 Torus Cons_hypoth95 Methyltransf_25 zf_CCCH_4 zf-CCCH_4 MTS
Motif
Other DBs
NCBI-GeneID: 102513537
NCBI-ProteinID: XP_006175434
Position
Un
AA seq 657 aa AA seqDB search
MSRARIVLWLSLTLRSARSLCRARFMEGQSQGPPNPAAMENGTQPCGEERPPEAQETTVT
EGAAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDVQKVVVD
LSEQEEDKAELKESPNLAPGDQPRTAAVGEICEEGLRVLEGLAASGLRSIRFAREVPGLQ
FVVANDASARAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQKASERFDVIDLDPYGSP
APFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHS
LDLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAFHLQR
LGKASGASGGRVKFSAACGPPVAPECEHCGQRHQLGGPLWAEPLHDLDFVGHVLEAVSAN
PSRFHTAERIRGVLSVITEELPDVPLYYTLDQLSSTVHCSTPSLLAPRSALLHAGFRVSI
SHACKNAVKTDAPSSALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIRDD
ANPSSRQRGLKRFQANPEANWGPRPRARPGGKAAGEAMEERRRLLQNKRKEPAEDPAQQA
ARLKTFPCKRFKEGTCQRGDQCCYSHSPPTSKVTTEATPSDCQNSPGPGAAAGPGVD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgcgaggatcgttctgtggctaagcctgactttgcgctctgctcgcagtctc
tgtagagcccggtttatggaggggcagtcccaagggccgccaaatccagcggcaatggag
aatggcacccagccctgcggagaagagcgcccacctgaggctcaggagactacagtcact
gagggggccgccaagatcgccttccctagtgccaacgaagtcttctataacccagtacag
gagttcaaccgggacctgacatgtgctgtgatcaccgagtttgctcgcattcagctgggg
gccaaaggaatccagatcaaggtgccaggcgaaaaggatgtgcaaaaggtggtcgtggac
ttgtcggagcaagaggaggacaaggctgaactgaaagagagtccaaacctggctccagga
gaccaacctcgaacagctgctgtgggggaaatctgtgaggagggcctgcgagtgctggag
ggcctggcagcctcgggcctacgttccattcgctttgcgcgagaggtgcctggactccaa
ttcgtggttgccaatgatgcctctgcccgagccgtggatctcatacgccgtaatgtgcag
ctcaatgatgtggcccatctggtacagcccagccaggcagatgcccggatgctgatgtac
cagcaccagaaggcgtcggagcggtttgatgtcatcgacctggacccgtacggcagcccc
gcccctttcctggatgcagccgtgcaggctgtgagcgaaggagggctgctgtgtgtgacc
tgcacggacatggcagtgctggcggggaacagcggggagacatgctatagcaagtacggg
gccatggccctcaagagccgggcctgccatgagatggccctgaggatcgtcctgcacagc
ctggacctccgtgccaactgctaccaacgcttcgtggtgccactgctcagcatcagcgct
gacttctatgtgcgtgtttttgttcgagtcttcactggtcaggccaaggtcaaggcctca
gccagcaagcaggcgctggtgtttcagtgtgtgggctgtggggccttccacctccagcgc
ctcggcaaagcatcaggagcctccggcggccgggtcaagttctctgcagcctgtggcccc
ccagtggcccccgagtgtgagcactgtgggcagcgacaccagcttggtggcccactgtgg
gcagagcccctccatgacctggacttcgtgggccatgtcctggaggctgtgagcgccaac
cccagccgcttccacacagctgagcggatccggggcgtcctgagtgtcatcaccgaggag
ctcccagacgttcctctctactacacgctggaccagctgagcagcaccgttcactgcagc
acgcccagcctcctggcccctaggtcggctctcctccacgctggcttccgggtctcaatc
tcccatgcctgtaagaatgccgtgaagacagatgccccctcctccgccctctgggacatc
atgcgctgctgggagaaggagtgcccagtgaaacgggagcgcctgtcggagaccagtccg
gcgttccgcattctcagtgtggagcccaggctgcaggccaacttcaccatccgggacgat
gccaaccccagctcccgccagcgaggactcaagcgcttccaggccaatcctgaggccaac
tggggtccccgaccgcgggcccgtccaggaggcaaggcagctggcgaagctatggaagag
agacgcaggctgctccagaataagcgaaaagagccggcggaggacccagcccagcaggct
gctcggctcaagacatttccctgcaagaggttcaaggagggcacctgtcaacggggggac
cagtgctgctactcccatagccccccgacatccaaggtcactactgaagccaccccctct
gactgtcagaattcccctgggcctggggctgctgctggtccaggtgtagactga

DBGET integrated database retrieval system