KEGG   Camelus ferus (Wild Bactrian camel): 102514944Help
Entry
102514944         CDS       T02979                                 

Gene name
HMGCS1
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00072  Synthesis and degradation of ketone bodies
cfr00280  Valine, leucine and isoleucine degradation
cfr00650  Butanoate metabolism
cfr00900  Terpenoid backbone biosynthesis
cfr01100  Metabolic pathways
cfr03320  PPAR signaling pathway
Module
cfr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102514944 (HMGCS1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    102514944 (HMGCS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102514944 (HMGCS1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102514944 (HMGCS1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102514944 (HMGCS1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     102514944 (HMGCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 102514944
NCBI-ProteinID: XP_006191982
Position
Un
AA seq 520 aa AA seqDB search
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCMTVVQNLMERNSLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVAML
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYRKKI
HARWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASILAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKIIASLCDLKSRLDSRTCVAP
DVFAENMKLREDTHHLGNYIPQSSVDSLFEGTWYLVRVDEKHRRTYARRPSLNDDTLDEG
VGLVHSSTAAEHIPSPAKKVPRLPATAAEPEAAVISNGEH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtcacttcctttgaatgcagaagcctgctggccaaaagatgtgggaattgtt
gcccttgagatctattttccttctcaatatgttgatcaagcagagttggaaaaatacgat
ggtgtagatgctggaaagtatactattggcttgggccaggccaagatgggcttctgcacg
gatagagaagatatcaactctctttgcatgactgtggttcagaatcttatggagagaaat
agcctttcttatgattgcattgggcggctagaagttggaacagagacgatcatcgacaaa
tcaaagtcagtgaagactaatctgatgcagctctttgaggagtctgggaatacagacata
gaagggatagacacgactaatgcgtgctatggaggcacagctgctgtcttcaatgctgtc
aactggatcgagtccagctcttgggatggacggtatgccctggtagttgcaggggatatt
gctgtatatgccacaggaaatgctagacctacgggtggagttggagctgttgctatgcta
attgggccaaatgctcctttaatttttgaacgaggacttcgtggaacacatatgcaacat
gcctatgacttttacaagcctgatatgctgtctgaatatcctatagtagatggaaaactc
tccatacagtgttacctcagtgcattagaccgctgctattctgtctaccgcaagaagatc
catgcccggtggcagaaagagggaaatgataaagatttcaccttgaatgactttggtttc
atgatcttccactcaccctattgtaaactggttcagaaatctctagcacggatgttgctg
aatgacttccttaatgaccagaacagagataaaaatagtatctatagtggcctagaagcc
tttggggatgttaaattagaagatacctactttgatagagatgtggaaaaggcatttatg
aaggctagttcagaactctttaatcagaaaacaaaggcatctttgcttgtgtcaaatcaa
aatggaaatatgtatacatcttcagtatatggttcccttgcttctattcttgcacagtac
tcacctcagcagctggcgggaaagaggattggcgtgttctcttatggctctggtttggct
gccaccctgtactccctcaaagttacacaagatgccacgccagggtctgctcttgataaa
ataatagcaagtttatgtgatctcaaatcaaggcttgactcaagaacttgtgtggcacca
gatgtctttgctgaaaacatgaagctcagagaagacactcatcacttgggcaactatatt
ccccagagttcagttgattcgctctttgaaggaacgtggtacctagttcgagtggatgaa
aagcacagaaggacttacgctcggcgcccctctctgaatgatgacactttggatgaaggg
gtaggactcgtgcattcaagcacagcagctgagcatattccaagtcctgctaagaaagtg
ccaagactccctgcaacagcagcagaaccagaagcagctgtcatcagtaacggggagcac
tga

DBGET integrated database retrieval system