KEGG   Camelus ferus (Wild Bactrian camel): 102519462Help
Entry
102519462         CDS       T02979                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00561  Glycerolipid metabolism
cfr01100  Metabolic pathways
cfr04714  Thermogenesis
cfr04723  Retrograde endocannabinoid signaling
cfr04923  Regulation of lipolysis in adipocytes
Module
cfr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102519462 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102519462 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102519462 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102519462 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfr01002]
    102519462 (MGLL)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102519462 (MGLL)
Peptidases [BR:cfr01002]
 Serine Peptidases
  Family S33
   102519462 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 Abhydrolase_3 Thioesterase PGAP1 DLH Peptidase_S9 LIDHydrolase Chlorophyllase2 Abhydrolase_2 DUF1057 BAAT_C
Motif
Other DBs
NCBI-GeneID: 102519462
NCBI-ProteinID: XP_006193646
Position
Un
AA seq 313 aa AA seqDB search
METGPKGSFRMPEESSPRRTPQSVPYRELPHLVNADGQYLFCRYWKPSGTPRALVFVSHG
AGEHCGRYDELARMLVGLGLLVFAHDHVGHGQSEGERMVVSDFQVFIRDVLQHVDLVQKD
HPGLPVFLLGHSMGGAIAILTAADRPGHFSGMILISPLVLANPESATTFKVLAAKVLNLV
LPNMSLGPIDSSMLSRNKAEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLP
FLLLQGSADRLCDSRGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINTWV
SQRTVVAGTGSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctaagggttctttcagaatgccggaggaaagttctcccagacggacc
ccgcaaagcgttccctatcgggagctccctcacctggtgaatgctgacggacagtacctc
ttctgcaggtactggaaaccctcgggcacacccagggccctggtctttgtgtcccatgga
gccggggagcattgtggccgctatgatgagctggctcggatgctggtgggcctggggctg
ctcgtgtttgcccacgaccacgtcggccacgggcagagcgagggggagaggatggtcgtg
tctgacttccaggtcttcatcagggatgtgttgcaacacgtggacctggtgcagaaggac
caccccgggcttccggtcttccttctgggccactccatgggaggggccattgccatcctg
acggccgcggacaggccgggccacttctccggcatgattctgatttccccgctggttctc
gccaaccccgagtccgcaacaaccttcaaggtccttgctgcgaaagttctcaaccttgtc
ctgccaaacatgtccctgggcccaattgactccagcatgctctcgcggaataaggcagag
gtggacctctacaacacggaccccctcatctgccgggcggggctcaaagtgtgctttggc
atccagctgctcaacgccgtgtcgcgggtggagcgggccctccccaagctgaccctgccc
ttcctgctgctgcagggctctgccgaccgcctgtgcgacagcagaggggcctacctgctc
atggagtccgccaagagccaggacaagacgcttaagatttacgaaggtgcctaccacgtc
ctccacaaagagcttcctgaagtaaccaactctgtcttccgtgagataaacacgtgggtc
tctcaaaggacagtggtggcgggaacagggtccccaccctga

DBGET integrated database retrieval system