KEGG   Camelus ferus (Wild Bactrian camel): 102519994Help
Entry
102519994         CDS       T02979                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  Jak-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05100  Bacterial invasion of epithelial cells
cfr05142  Chagas disease (American trypanosomiasis)
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  HTLV-I infection
cfr05167  Kaposi's sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05418  Fluid shear stress and atherosclerosis
Module
cfr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102519994 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102519994 (PIK3CB)
   04015 Rap1 signaling pathway
    102519994 (PIK3CB)
   04012 ErbB signaling pathway
    102519994 (PIK3CB)
   04370 VEGF signaling pathway
    102519994 (PIK3CB)
   04630 Jak-STAT signaling pathway
    102519994 (PIK3CB)
   04668 TNF signaling pathway
    102519994 (PIK3CB)
   04066 HIF-1 signaling pathway
    102519994 (PIK3CB)
   04068 FoxO signaling pathway
    102519994 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102519994 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102519994 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102519994 (PIK3CB)
   04024 cAMP signaling pathway
    102519994 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102519994 (PIK3CB)
   04152 AMPK signaling pathway
    102519994 (PIK3CB)
   04150 mTOR signaling pathway
    102519994 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102519994 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102519994 (PIK3CB)
   04218 Cellular senescence
    102519994 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102519994 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102519994 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102519994 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102519994 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102519994 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102519994 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102519994 (PIK3CB)
   04660 T cell receptor signaling pathway
    102519994 (PIK3CB)
   04662 B cell receptor signaling pathway
    102519994 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102519994 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102519994 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102519994 (PIK3CB)
   04062 Chemokine signaling pathway
    102519994 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102519994 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    102519994 (PIK3CB)
   04915 Estrogen signaling pathway
    102519994 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102519994 (PIK3CB)
   04917 Prolactin signaling pathway
    102519994 (PIK3CB)
   04926 Relaxin signaling pathway
    102519994 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102519994 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102519994 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102519994 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    102519994 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102519994 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102519994 (PIK3CB)
  Development
   04360 Axon guidance
    102519994 (PIK3CB)
   04380 Osteoclast differentiation
    102519994 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    102519994 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102519994 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102519994 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102519994 (PIK3CB)
   05231 Choline metabolism in cancer
    102519994 (PIK3CB)
   05205 Proteoglycans in cancer
    102519994 (PIK3CB)
   05203 Viral carcinogenesis
    102519994 (PIK3CB)
   05210 Colorectal cancer
    102519994 (PIK3CB)
   05212 Pancreatic cancer
    102519994 (PIK3CB)
   05225 Hepatocellular carcinoma
    102519994 (PIK3CB)
   05226 Gastric cancer
    102519994 (PIK3CB)
   05214 Glioma
    102519994 (PIK3CB)
   05221 Acute myeloid leukemia
    102519994 (PIK3CB)
   05220 Chronic myeloid leukemia
    102519994 (PIK3CB)
   05218 Melanoma
    102519994 (PIK3CB)
   05211 Renal cell carcinoma
    102519994 (PIK3CB)
   05215 Prostate cancer
    102519994 (PIK3CB)
   05213 Endometrial cancer
    102519994 (PIK3CB)
   05224 Breast cancer
    102519994 (PIK3CB)
   05222 Small cell lung cancer
    102519994 (PIK3CB)
   05223 Non-small cell lung cancer
    102519994 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102519994 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102519994 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102519994 (PIK3CB)
   04931 Insulin resistance
    102519994 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102519994 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    102519994 (PIK3CB)
   05166 HTLV-I infection
    102519994 (PIK3CB)
   05162 Measles
    102519994 (PIK3CB)
   05164 Influenza A
    102519994 (PIK3CB)
   05161 Hepatitis B
    102519994 (PIK3CB)
   05160 Hepatitis C
    102519994 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102519994 (PIK3CB)
   05169 Epstein-Barr virus infection
    102519994 (PIK3CB)
   05165 Human papillomavirus infection
    102519994 (PIK3CB)
   05146 Amoebiasis
    102519994 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    102519994 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    102519994 (PIK3CB)
   01524 Platinum drug resistance
    102519994 (PIK3CB)
   01522 Endocrine resistance
    102519994 (PIK3CB)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102519994 (PIK3CB)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102519994 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 102519994
NCBI-ProteinID: XP_006177534
Position
Un
AA seq 1070 aa AA seqDB search
MCFHSIMPPAMADILDIWAVDSQIGSDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRSTIHGKEDE
VSPHDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFHIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASNDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVMLSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttccactccataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagataggatctgatggctccatacctgtggacttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcacaattacccaatgtttaacctccttatggaaattgattcctatatgttt
gcatgtgtgaatcagactgctgtgtacgaggagctcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggcagaggtctgcatgaatttgatgccttg
aaggatcctgaagttaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcagacctatccaccagagcat
gaaccatccatccttgagaatttagaagataagctttatggaggaaagcttattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaacatgaatcct
atcaaaataaatgaattggcaatccaaaaacgttcgactattcatgggaaagaagatgaa
gttagcccccatgactatgtgttgcaagtcagtgggagagtagagtatgtgtttggtgat
caccccctaattcagttccagtatatccggaactgtgtgatgaacaggaccttgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtacgaacaggaaatgattgccatc
gaggccgccataaatcgaaattcgtctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccacattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacggatggctcgatta
tgttttgctgtttatgcagttttggataaagtcaaaacgaagaaatcaactaaaactatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtgcattatcctgtagcgtgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagatataatactgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatactgaaaatgcaacagctttgcacatcaaatttccagagaataaaaag
caaccttattactaccctccttttgataagattattgaaaaggcagctgagattgcaagc
aatgatagtgctaatgtgtcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataagcttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctcgatttcaactatccagatcagtacgtgcga
gaatatgcagtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctccagattccta
ttagaaagagcacttgctaatcggaggatagggcagtttctattttggcaccttaggtca
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgtcgg
ggaagtgtaggtcacatgaaagcactttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtctaatcaaactgaatgcagtgaagctaaatagagccaaagggaaggag
gccatgcacacttgtttaaaacagaatgcttaccgggaagccctttctgacctgcagtca
cctctgaacccgtgtgtcatgctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcccttgtggctggtgtacaacaacaaggtgtttggagaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaagatatgttgactctccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttcggatgttgccttacggc
tgtttagcaacaggagaccgctccggcctcattgaagttgtgagcacctctgaaacaatc
gctgacattcagctaaacagtagcaatgtggctgctgcagcagccttcaacaaagacgcc
cttctgaactggcttaaagagtacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgacttcattcatgtgattcagcaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

DBGET integrated database retrieval system