KEGG   Camelus ferus (Wild Bactrian camel): 102520865Help
Entry
102520865         CDS       T02979                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04064  NF-kappa B signaling pathway
cfr04672  Intestinal immune network for IgA production
cfr05166  Human T-cell leukemia virus 1 infection
cfr05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102520865 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102520865 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102520865 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102520865 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102520865 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cfr04050]
    102520865 (TNFRSF13C)
   04090 CD molecules [BR:cfr04090]
    102520865 (TNFRSF13C)
Cytokine receptors [BR:cfr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102520865 (TNFRSF13C)
CD molecules [BR:cfr04090]
 Proteins
  102520865 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 102520865
NCBI-ProteinID: XP_014423377
Position
Un
AA seq 181 aa AA seqDB search
MGFSSMRRGARGLRGRDGPAPTQCLQTQCFDVLVRNCVACSLLRTPEPRPGKSRPLGRLS
TGRPWRGKRVLSQRPPPCQSLRHGLHLPQDLGGHLINGSVWPGDGMGTSQPPETPEAPGS
DEPLDNVTILSPGTLDVTAPIWLPPSEDPATTPPAHSIPVPATELGSTELVTTKTAGPEQ
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcagcagcatgaggcgaggggcgaggggtctgaggggcagggatgggccggca
cccacgcagtgcctgcagactcagtgcttcgacgtgctggtccgcaactgcgtggcctgc
agtctcctccggacgccggagcctagaccgggtaagagtcgaccgctgggacgactgagc
acagggcggccctggagagggaagagggtcctgtcacagaggcctccaccctgccagagt
ctcaggcatggcctccacctgccccaggacctgggaggtcacctgattaacgggagtgtg
tggcctggggatgggatggggaccagccaacctccggagaccccagaagccccgggcagc
gacgagcccctggacaatgtcaccatcctctcccctggaaccctggatgtcacagctcct
atctggcttccacccagtgaagacccagccactaccccacctgcccacagcatccctgtg
ccagccacagagctgggttccactgagctggtgaccaccaagacggccggccctgagcaa
cagtag

DBGET integrated database retrieval system