KEGG   Camelus ferus (Wild Bactrian camel): 102521559Help
Entry
102521559         CDS       T02979                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr03040  Spliceosome
cfr04010  MAPK signaling pathway
cfr04141  Protein processing in endoplasmic reticulum
cfr04144  Endocytosis
cfr04213  Longevity regulating pathway - multiple species
cfr04612  Antigen processing and presentation
cfr04915  Estrogen signaling pathway
cfr05134  Legionellosis
cfr05145  Toxoplasmosis
cfr05162  Measles
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102521559 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102521559 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102521559 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102521559 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102521559 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102521559 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102521559 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102521559 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    102521559 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102521559 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 102521559
NCBI-ProteinID: XP_006180341
UniProt: S9XA40
Position
Un
AA seq 650 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagggacctgcagttggcattgatcttggcaccacctattcctgtgtgggtgtc
ttccagcacgggaaagtggagataattgccaatgatcagggaaaccgaaccaccccaagc
tatgtcgctttcaccgatacggaaaggttgatcggtgatgctgcaaagaaccaagttgcg
atgaaccccaccaacacggtttttgatgccaaacgtctcattgggcgaagatttgatgat
gctgttgtccaatctgatatgaaacattggcccttcatggtggtgaatgacgcaggcagg
cctaaagtccaagtagaatacaagggagagacaaaaagcttctatccagaggaggtgtca
tccatggttttgacaaagatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctgtggtcacagtacccgcttacttcaatgactctcagcgtcaggcgaccaaagat
gctggaactattgctggtctcaatgtacttagaatcatcaatgagccaactgctgctgct
attgcttatggcttagacaaaaaggttggagctgaaagaaatgtgctgatctttgacttg
ggtggtggcacttttgatgtgtcaatcctcactattgaggatggaatctttgaggtcaag
tctactgccggagatacccatttaggtggagaggactttgacaaccgaatggtcaaccat
tttattgcagagttcaagcggaagcacaagaaggacatcagcgagaacaagagggctgtc
cgtcgcctccgcactgcttgtgagcgtgctaagcgcactctctcttccagcacccaggcc
agtattgagattgattccctctatgaaggaatcgacttttatacctctattacccgtgcc
cgatttgaagaattaaatgctgaccttttccgtggcaccctggaccctgtggagaaagct
cttcgggatgcgaaactggacaaatcacagatccatgacatcgtcttggtgggaggctca
actcgtatacccaagattcagaaacttctgcaggacttcttcaatgggaaagaactgaat
aagagcatcaaccctgatgaggctgttgcttatggtgcagctgtccaggcagccatttta
tctggagacaaatctgaaaatgttcaagacttgctgctattggatgtcactcctctttcc
cttggaatcgaaactgcgggtggagtcatgactgtcctcatcaagcgcaataccaccatc
cccactaagcagacgcagaccttcaccacctactctgacaaccagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaacctgcttggcaagtttgaa
ctcacaggcattcctcctgccccccgtggcgttcctcagattgaagtcactttcgatatt
gatgccaatggcatccttaatgtgtctgctgtggataagagcacagggaaggagaacaaa
attaccatcacaaacgacaagggccgtttgagcaaggaagacatagagcgcatggtccag
gaagccgagaagtacaaagctgaagatgagaagcagcgggacaaggtgtcttcaaagaat
tcacttgaatcctatgctttcaacatgaaagctactgttgaagatgaaaaacttcaaggc
aagatcaatgatgaagacaaacagaagattcttgataagtgtaatgaaataatcaactgg
cttgataagaaccagactgcagagaaggaggaatttgaacatcaacagaaggagctggaa
aaagtctgcaacccaatcattaccaagctgtaccagagtgcaggaggcatgcccggcggg
atgccaggaggcatgcctgggggcttccctggcggtggagcacctccatctggtggtgcc
tcctctgggcccaccatcgaagaggttgattaa

DBGET integrated database retrieval system