KEGG   Camelus ferus (Wild Bactrian camel): 102522017Help
Entry
102522017         CDS       T02979                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04520  Adherens junction
cfr04910  Insulin signaling pathway
cfr04913  Ovarian steroidogenesis
cfr04923  Regulation of lipolysis in adipocytes
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr04960  Aldosterone-regulated sodium reabsorption
Module
cfr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102522017 (INSR)
   04015 Rap1 signaling pathway
    102522017 (INSR)
   04010 MAPK signaling pathway
    102522017 (INSR)
   04066 HIF-1 signaling pathway
    102522017 (INSR)
   04068 FoxO signaling pathway
    102522017 (INSR)
   04072 Phospholipase D signaling pathway
    102522017 (INSR)
   04022 cGMP - PKG signaling pathway
    102522017 (INSR)
   04151 PI3K-Akt signaling pathway
    102522017 (INSR)
   04152 AMPK signaling pathway
    102522017 (INSR)
   04150 mTOR signaling pathway
    102522017 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102522017 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102522017 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102522017 (INSR)
   04913 Ovarian Steroidogenesis
    102522017 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102522017 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102522017 (INSR)
   04213 Longevity regulating pathway - multiple species
    102522017 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102522017 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102522017 (INSR)
   04931 Insulin resistance
    102522017 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102522017 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:cfr04090]
    102522017 (INSR)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102522017 (INSR)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102522017 (INSR)
CD molecules [BR:cfr04090]
 Proteins
  102522017 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 102522017
NCBI-ProteinID: XP_014408597
Position
Un
AA seq 1462 aa AA seqDB search
MFCGGPEEPEIMGFGAGSGRACARGLGKARDGTAHRFSQSLERAGQEWLSAELAMGADCV
RVPAGSGDATHVLFGSSPRSGVTGQPRTAKCLGCTQFGARVEGDGLEVAWGVPAVCPGMD
IRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESL
KDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATID
WSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVC
PTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWR
CVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVC
HLLEGEKTIDSVTSAQELRGCTIVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR
SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNP
KLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSHDKILLKWEPY
WPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPMRSNDPKSQNHPGWL
MRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQII
LKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQ
TEYEEAAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPGAEDTRPSR
RRRALADIGNGTAAVPTLPGFPNASSTSAPTSSEEHRPFEKVVSKESLVISGLRHFTGYR
IELQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNG
LIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEA
TYFYVTDYYVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYL
SASDVFPCSVYVPDEWEVPREKIALLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVN
ESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRP
EAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGM
TRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGL
SNEQVLKFVMDGGYLDQPDNCPDRVTNLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPE
VSFFHSEENKAPESEELDMEFEDMESVPLDRSAHSQREEAGGRDAGSALGLKRGYEEHIP
YTHMNGGKRNGRILTLPRSDPS
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtgggggccctgaggagccagagatcatgggatttggggctggctcaggcaga
gcctgtgcccgaggtttagggaaggcgcgagatgggacggcccatcgcttcagccagagc
ttggagagggctggccaggagtggttgagtgccgagctagccatgggggctgactgtgtg
agagtcccagctggctccggagacgcgacacacgtcctctttgggtcgtctccgagaagc
ggggtcactggacagcctcggacagccaaatgcctggggtgcacacagtttggagccaga
gtcgagggagacggactggaggtcgcctggggggtcccagctgtgtgccccggcatggac
atccggaacaacctcacccggctgcacgagctggccaactgctccgtcatcgaaggacat
ctgcagatactgctgatgttcaaaacgaggcctgaggatttccgagacctcagtttcccc
aaactcatcatgatcaccgattacttgctgctcttccgggtctacgggctggagagcctg
aaggacctgttccccaacctcacggtcatccggggctcccgcctcttcttcaactatgcg
ctggtcatcttcgagatggttcacttgaaggagcttggcctctacaatttgatgaacatt
acgcggggctcggtccgcatcgagaagaacaatgagctctgctacctggccaccattgac
tggtcgcgcatcctggactccgtggaggataattacatcgtgctgaacaaagatgacaac
gaggaatgtggggacatttgtccaggcactgccaagggcaaaaccaactgccctgccact
gtcatcaatgggcaatttgtcgagcggtgttggacgcacagccactgtcagaaagtttgt
ccgaccatctgcaagtcgcacggctgcaccgcggagggcctctgctgccacagcgagtgc
ttgggtaactgctccgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctac
ctggacggccgctgcgtggagacctgcccgcccccctactaccacttccaagactggcgc
tgcgtgaacttcagcttctgccaggatctgcacaacaaatgcaagaactctcggaggcag
ggctgccaccagtacgtcattcacaataacaagtgcatccccgagtgtccctctgggtac
acgatgaattccagcaacttgatgtgcactccatgcctgggcccctgtcccaaggtctgc
cacctcctggaaggcgagaagaccatcgactcagtgacgtccgcccaggagctccgaggc
tgcaccattgtcaacgggagcttaatcatcaacattcgagggggcaacaatctggcagct
gagctggaggccaaccttggactcattgaagaaatttcagggtacctgaaaatccgccgg
tcctacgccctcgtgtcactttccttcttccggaagttacgtctgattcgaggagagacc
ttggagattgggaactactccttctacgccttggacaaccagaacctaaggcagctgtgg
gactggagcaaacacaacctcaccatcacgcaggggaaactgttcttccactataacccc
aagctctgcttgtcagaaattcacaagatggaggaagtttcaggaaccaaggggcgccag
gagagaaacgacattgccctgaagaccaatggggaccaggcgtcctgtgaaaatgaatta
cttaaattctcttacattcggacatctcatgacaagatcttgctgaaatgggagccctat
tggccccctgacttccgagatctcttggggttcatgcttttctacaaagaggccccttat
cagaacgtgacagagttcgatggacaggatgcgtgcggctccaacagctggacggtggtg
gacattgacccgccgatgaggtccaatgaccccaagtcacagaaccaccccgggtggctg
atgcggggtctcaagccctggacccagtacgccatctttgtcaagaccttggtcaccttt
tctgacgaacgccgcacgtacggggccaagagcgacatcatctatgtccagacagatgcc
actaatccttccgtcccactggatcccatctcggtttctaattcctcatcccagattatt
ctgaagtggaagcctccctctgaccccaacggcaacatcacacactacctggttttctgg
gagaggcaggcggaagacagcgagctgtatgaattggattattgcctcaaagggctgaag
ctgccgtcccggacctggtctccgccgtttgagtctgagggctcccagaagcacaatcag
accgagtacgaggaggctgccggagagtgctgctcctgcccgaagaccgactctcagatc
ctgaaggagctggaggaatcctcgttccggaagacatttgaggattacctgcacaatgtg
gttttcatccccagaaaatcctcttcaggccctggcgcggaggacaccaggccgtcgcgg
agacgcagggccctggctgacatagggaatggcacagcggccgtgcccacgctcccgggg
ttccccaacgcctcctccaccagcgcacccaccagctcggaggagcacagacccttcgag
aaagtggtgagcaaagagtcactggtcatctcggggctgcgtcactttaccggctaccgc
atcgagctgcaggcttgcaaccaagatgcccccgaggagcggtgcagcgtggccgcctac
gtcagcgccaggaccatgcccgaagccaaggccgatgatattgtgggccccgtgacccac
gaaatcttcgagaacaacgtcgtccacctgatgtggcaggagcccaaggaacccaacggt
ctgatcgtgctctatgaagtgagctaccgacgatacggcgatgaggagctgcacctgtgc
gtctctcgaaggcatttcgctctggagcggggctgcaggctgcgcgggctgccgcccggg
aattacagcgtgagagttcgggccacctccctggcgggcaacggctcctggacagaagcc
acttatttctatgtgacagattattacgtcccatcaaatattgcaaagattatcatcggc
cccctcatctttgtatttctcttcagtgttgtgattgggagtatttatctgttcctgaga
aagaggcagccggatgggccactgggaccactgtatgcttcttcgaaccccgagtacctc
agtgccagcgatgtgttcccgtgttctgtgtacgtgccggacgagtgggaggtgccccgg
gagaagatcgcgctgctgcgagagctcgggcagggctccttcggcatggtgtacgagggc
aacgccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacggtcaac
gagtcggccagcctgcgagaacggattgagtttctcaacgaggcctcggtcatgaagggc
ttcacctgccaccacgtggtccgcctcctgggggtggtgtccaaaggccagccgacactg
gtggtgatggagttgatggctcacggagacttaaagagctacctccgttccctgcggccg
gaggccgagaataaccctggtcgccctccccctacgctgcaagagatgattcagatggcg
gcggagattgccgatgggatggcgtacctgaacgccaagaagttcgtgcaccgggacctc
gcagctcggaactgcatggtcgctcatgattttaccgtcaaaatcggagactttggaatg
accagagacatctacgaaacggactactaccggaaagggggcaagggcctgctccccgtg
cggtggatggcacccgaatccctgaaggacggggtcttcaccacttcttccgacatgtgg
tccttcggcgtggtcctctgggaaattaccagcttggcagaacagccttaccaaggccta
tctaatgagcaggtgttgaaattcgtcatggatggagggtatctggatcaacctgacaac
tgtccagacagagtcaccaacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgaccttcctggagatcgtcgacctgctcaaggacgacctgcaccccagctttcccgaa
gtttccttcttccacagcgaggagaacaaggcgccggagagcgaggagctggacatggag
tttgaggacatggagagcgtcccgctggaccggtcggcacactcgcagcgggaggaggcc
gggggccgggacgcggggtcggcgctggggctgaagcggggctacgaggagcacatcccc
tacacccacatgaacgggggcaagaggaacggccgcatcctgaccctgccgcggtccgac
ccttcctaa

DBGET integrated database retrieval system