KEGG   Camelus ferus (Wild Bactrian camel): 102522961Help
Entry
102522961         CDS       T02979                                 

Gene name
MTMR7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr01100  Metabolic pathways
cfr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102522961 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102522961 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102522961 (MTMR7)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102522961 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102522961 (MTMR7)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102522961 (MTMR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase CREPT Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 102522961
NCBI-ProteinID: XP_006192936
Position
Un
AA seq 661 aa AA seqDB search
MEHIRTPKVENVRLVDRISSKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQLLQLIIPQERDCHDVYLSLVRLARPVKYEELYCFSFNPKLDK
EEREQGWMLIDLGEEYKRMGLPNNYWQLSDVNRDYRVCDSYPADLYVPRSATAHIIVGSS
KFRSRRRFPALSYYYRENHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAILDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQNHIYSCQFGNFLCNSQKERQELKIQERTHSSWAHLWKNRAEYLNPLFRADHS
QTRGALRLPTAPCSFTHKFWSGMYNRFEKGLQPRQSVTDYLMAVKEESQQLEEELAALGE
RLEKIQKVQLNRTEVKSNKQSEPSKHSGFSTSDNSTANTPQDYSGNVKSFPSRSPSQGDE
DSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSSKDRDSDEAVFLT
A
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgcacgcccaaggtcgaaaatgtccgcttggtagatcgaatctcttct
aaaaaagcagccctcggtactttgtatctgacggctacccatgtcatatttgtggaaaat
gcacctgacacaagaaaagaaacctggattcttcacagtcagatttccaccatcgagaaa
caggctacaaccgctactgggtgccctctgcttatccgctgcaagaactttcagctcttg
caactcatcatcccccaggaaagggactgccacgacgtctacctctccctcgtccgccta
gcaaggccagtgaagtatgaggagctatactgcttctcattcaaccccaagctggacaaa
gaagaaagggagcagggctggatgctgatcgatctcggtgaagagtacaagcgaatgggc
ctccctaataactactggcagctcagcgatgtgaacagagattacagagtttgtgattcc
taccctgccgacctgtacgttcccaggtcggccacggcgcacatcatcgtggggagttcc
aagttcaggagcagacggcggtttcctgcgctttcttactactacagagagaaccacgcc
tccatctgccggagcagccagcccctgtccggcttcagtgcccgctgcctggaggacgag
cagatgctccaggccatcaggaaggccaacccaggaagcgacttcatttacgtcgtggac
actcggcctaaacttaatgcgatggcaaatcgtgctgcagggaaaggctatgagaatgaa
gacaattattccaatatcaagtttcagtttatcgggatagagaacatccatgtcatgagg
aacagtctgcagaaaatgctggaagtgtgtgaacttaaatctccctccatgagtgatttt
ctgtggggactggagaactctggctggctgaggcacattaaggccatcctggatgcaggg
atcttcattgcaaaggcagtttcagaggaaggagcaagtgtacttgttcactgttccgat
ggctgggacaggactgctcaggtgtgctcggtggccagcctcctgctggaccctcactac
aggaccttgaagggcttcatggtattaattgaaaaggactggatttcctttggtcataaa
tttaatcacaggtacggcaatctagacggggacccaaaagaaatctctccagttattgac
cagttcattgagtgcgtctggcagctaatggaacaatttccctgtgcctttgagttcaat
gagaggtttctgattcacattcaaaatcatatctattcctgccagtttggaaacttccta
tgtaacagccaaaaggagaggcaagaactcaaaatccaggaaagaacacactcttcctgg
gctcatctgtggaagaatcgggctgaatacctgaaccctctgttcagagctgaccacagc
cagacccgcggagcccttcgcctccccacggcgccgtgcagcttcacgcacaagttttgg
agtggaatgtacaaccgctttgaaaagggcctgcagccccgacagtcagtcacagattac
ctcatggccgtgaaggaggagagccagcagctggaggaggagctcgcggccctaggagaa
aggctggaaaaaattcagaaagtccagttaaatcgcactgaagtgaagagtaataagcaa
agtgaacccagcaaacactcagggttttctacctcagacaacagcacagccaacacgccc
caggactacagtggaaacgtgaaatcatttccgtccaggagcccttcacaaggcgatgaa
gattctgctctgattctaacccaagacaacttgaaaagctcagaccctgatctgtcagcc
aacagtgaccaagagtctggggtggaggatttgagctgccgctctccgagtggcggggag
catgccccgagcgaggacagcagcaaggaccgagattccgacgaggccgtcttcctcact
gcctga

DBGET integrated database retrieval system