KEGG   Camelus ferus (Wild Bactrian camel): 102523965Help
Entry
102523965         CDS       T02979                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04136  Autophagy - other
cfr04140  Autophagy - animal
cfr04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102523965 (ATG16L1)
   04136 Autophagy - other
    102523965 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102523965 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102523965 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:cfr03029]
    102523965 (ATG16L1)
Membrane trafficking [BR:cfr04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102523965 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102523965 (ATG16L1)
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102523965 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160 Fez1 TolB_like Lebercilin DUF4407 V_ATPase_I Phage_GPO
Motif
Other DBs
NCBI-GeneID: 102523965
NCBI-ProteinID: XP_006191193
Position
Un
AA seq 523 aa AA seqDB search
MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDKEMQMNEAKIAECLQTISDLETE
CLELRTKLQDLERANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANR
LNAENEKDSRRRQARLQKELAEAAKEPLPIEQDDDIEVIVDETSDHTEETSPVRAISRAA
TKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSSKEVRVPTTAMYVFDAHDGE
VNAVQFSPGSRLLATGGMDRRVKLWEVFGDKSEFKGSLSGSNAGITSIEFDSAGSYLLAA
SNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIK
TVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELL
SCSRDDLLKIIDLRINAVRQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVL
SGKVEKVLSKHHSSSINAVAWSPSGSHVVSVDKGSKAVLWSEY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgaggattaaacaccaagaagaactgaccgaattacacaagaaacgtggg
gagttggctcagttggtgattgacctgaataaccaaatgcagcagaaggacaaagagatg
cagatgaatgaagccaaaattgcagaatgtttgcagaccatctctgacctggagactgag
tgcctagaactacgcactaagcttcaggaccttgaaagagccaaccagaccctgaaggat
gagtacgatgccctgcagatcaccttcactgccctggaggagaaactgcggaaaactact
gaagagaaccaggagctggtcaccagatggatggctgagaaagcccaggaagccaaccgc
ctaaatgcagagaatgaaaaggattcgaggcggcggcaagcccggctgcagaaagagctt
gcagaagcagcaaaggaacctctaccaattgagcaggacgatgacattgaagtcattgtg
gacgagacctctgatcacaccgaggagacctctccagtgcgagccatcagcagagcggcc
actaagcgactctcgcagcctgctggaggccttctggattctatcactaatatctttggg
aggcgctctgtctcttcctttccagttccccaggataacgtggatactcatcctggttct
agtaaagaagtgagggtgccaacgactgcaatgtatgtctttgacgctcacgatggggag
gtcaacgctgtgcagttcagtccgggttcccggcttctggccacaggaggcatggatcgg
agggtgaagctttgggaagtgtttggagacaaatctgagttcaagggttccctctccggc
agtaatgcaggaattacaagtattgagtttgatagtgctggatcttacctcttagcggca
tcaaatgactttgcaagccgaatctggactgtggacgactatcggttacggcacacactc
acaggacacagtggcaaagtgctgtctgccaagttcctgctggacaacgcgcgtattgtt
tctggaagtcatgaccggaccctcaaactctgggatctacgcagcaaagtctgcataaag
acggtatttgcgggatccagctgcaatgatattgtctgcacagagcagtgtgtaatgagt
ggacattttgacaagaaaattcgcttctgggacatccgatcagagagtatcgtccgagag
atggaactcttgggaaagattactgccctggacttaaacccagagagaaccgaactcctc
agctgctcccgtgatgacctgctaaaaattattgacttacgaataaacgcagtcagacag
acattcagtgctcctggcttcaagtgcggttctgattggacgagagtcgtgttcagccct
gacggcagttacgtggcagccggctcggccgagggctctctctacatctggagcgtgctc
tctgggaaggtggagaaggtcctttcaaagcatcacagctcgtcaatcaacgcggtggcc
tggtccccctccggctcccacgtcgtcagtgtggacaaaggaagcaaagctgtgctgtgg
tcagaatactga

DBGET integrated database retrieval system