KEGG   Camelus ferus (Wild Bactrian camel): 102524031
Entry
102524031         CDS       T02979                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00230  Purine metabolism
cfr01100  Metabolic pathways
cfr01522  Endocrine resistance
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04114  Oocyte meiosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04270  Vascular smooth muscle contraction
cfr04371  Apelin signaling pathway
cfr04540  Gap junction
cfr04611  Platelet activation
cfr04713  Circadian entrainment
cfr04714  Thermogenesis
cfr04723  Retrograde endocannabinoid signaling
cfr04724  Glutamatergic synapse
cfr04725  Cholinergic synapse
cfr04727  GABAergic synapse
cfr04742  Taste transduction
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04911  Insulin secretion
cfr04912  GnRH signaling pathway
cfr04913  Ovarian steroidogenesis
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04918  Thyroid hormone synthesis
cfr04921  Oxytocin signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04925  Aldosterone synthesis and secretion
cfr04926  Relaxin signaling pathway
cfr04927  Cortisol synthesis and secretion
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr04970  Salivary secretion
cfr04971  Gastric acid secretion
cfr04972  Pancreatic secretion
cfr04976  Bile secretion
cfr05032  Morphine addiction
cfr05163  Human cytomegalovirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102524031 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102524031 (ADCY4)
   04371 Apelin signaling pathway
    102524031 (ADCY4)
   04020 Calcium signaling pathway
    102524031 (ADCY4)
   04072 Phospholipase D signaling pathway
    102524031 (ADCY4)
   04024 cAMP signaling pathway
    102524031 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102524031 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102524031 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102524031 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102524031 (ADCY4)
   04062 Chemokine signaling pathway
    102524031 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102524031 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102524031 (ADCY4)
   04912 GnRH signaling pathway
    102524031 (ADCY4)
   04913 Ovarian steroidogenesis
    102524031 (ADCY4)
   04915 Estrogen signaling pathway
    102524031 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102524031 (ADCY4)
   04921 Oxytocin signaling pathway
    102524031 (ADCY4)
   04926 Relaxin signaling pathway
    102524031 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102524031 (ADCY4)
   04918 Thyroid hormone synthesis
    102524031 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102524031 (ADCY4)
   04916 Melanogenesis
    102524031 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102524031 (ADCY4)
   04927 Cortisol synthesis and secretion
    102524031 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102524031 (ADCY4)
   04270 Vascular smooth muscle contraction
    102524031 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102524031 (ADCY4)
   04971 Gastric acid secretion
    102524031 (ADCY4)
   04972 Pancreatic secretion
    102524031 (ADCY4)
   04976 Bile secretion
    102524031 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102524031 (ADCY4)
   04727 GABAergic synapse
    102524031 (ADCY4)
   04725 Cholinergic synapse
    102524031 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102524031 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102524031 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102524031 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102524031 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102524031 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102524031 (ADCY4)
   04714 Thermogenesis
    102524031 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102524031 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102524031 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102524031 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102524031 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102524031 (ADCY4)
   05163 Human cytomegalovirus infection
    102524031 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102524031 (ADCY4)
Enzymes [BR:cfr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102524031 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102524031
NCBI-ProteinID: XP_006172896
Position
6
AA seq 1076 aa
MARLFSPRPSPSEDLFFAETYYILSQQYPLLLLLLVIVICGLLALLAVASASGRELASDP
GFLTTVLCALGGFSLLLGLASCEQRLQRWTRPLSGLVWAALLALGHGLLFTGGVVSAWDQ
VSFFLFVIFTVYAMLPLDMREAAAAGLASSLSHLLALGLCLGPQPDSRPALLPQLAANAV
LFLCGNVAGAYHKALMERALRATFREALSSLHSRWRLDTEKKHQEHLLLSILPAYLAREM
KAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLN
ELFGKFDQIAKDHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAAT
GVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLA
GAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMT
RYLESWGAAKPFAHLSHVESPVSTSTPLPERALSSFSPQWSLDRSRTPRGLDDELDTGDA
KFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNF
IIQMLVTNRPPALAITYSITFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSVLVATQ
PGLRVALGTATILLVFAMAITSLVFLPAASNCPFRAPNVSSVAFNFSWELPGSLPLISVP
YSMHCCVLGLLSCSLFLHMSFELKLLLLLLWLVASCSVFLHSHAWLSDCLVARLYPGPLD
SRPGVLKEPKLMGAICFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTR
LLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECL
RLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDSQQDSERSCSHLGTM
VEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMES
TGVLGKIQVTEETAGALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRAGPPSSL
NT seq 3231 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgtcccccagcgaagacctcttcttcgctgagacc
tactacatcctgagccagcagtacccactgctgctactgctgctggtgatcgtgatctgc
gggctcctggctctactggctgtcgccagtgccagcggcagggagctggcctccgaccct
ggcttcctgaccactgtgctgtgcgcgctgggtggcttctcgctactgctgggcctggct
tcctgtgagcagcgactgcagcgctggacgcgtcccctgtccggccttgtgtgggcagcg
ctgctcgcgctaggtcacggcctcctgttcaccgggggcgtggtgagcgcctgggaccag
gtgtcctttttcctttttgtcatcttcacggtgtatgccatgttgcccttggacatgcgg
gaagccgccgccgcgggcctcgcctcctcactctcacatctgctggccctcgggctgtgt
cttgggcctcagccggactcacggcccgcgctgctgccgcagctggcagcaaacgcggtg
ctgttcctgtgcgggaacgtggcgggagcgtaccacaaggctctgatggagcgcgcactg
cgcgccacgttccgggaggcgcttagttctctgcactcacgttggcggctggacaccgag
aagaagcaccaggaacaccttctcttgtccatccttcctgcctacctggcacgagagatg
aaggcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaac
aacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatc
gtgggcttcacacggctggccagtgagtgctcccctaaggaattggtgctcatgctcaac
gagctctttggcaagttcgaccagatcgccaaggaccatgaatgcatgaggatcaagatc
ctgggagactgttactactgtgtctctgggctgccgctctccctgccagaccacgcaatc
aattgtgtgcgcatggggctggatatgtgccgggccatcaggaaacttcgggcagccacc
ggcgtggatatcaacatgcgtgtgggtgtacactcgggcagcgtgctctgtggtgtcatc
ggactgcagaaatggcaatatgatgtctggtcccatgacgttacactggccaaccacatg
gaggcgagtggagtgccaggacgagtacatatcacaggggctacactggccctgctggca
ggggcttatgctgtggaggatgcagccatggaacaccgggacccataccttcgggagcta
ggggagcctacctacctggtcattgatccccgggccgaggaggaggatgagaagggcact
gctggagggttgctgtcctctctcgagggccccaagatgcgtccatcactgctgatgacc
cgctacctggagtcctggggtgcagccaagccatttgcccatctgagccacgtagagagc
cctgtgtccacctccacccctctcccggagagggccctgtcttccttcagcccccagtgg
agcctggaccggagccgtaccccccggggactggatgatgaactggacactggggatgcc
aagttcttccaggtcatcgaacagctcaactctcagaaacagtggaaacagtcaaaggac
ttcaaccctctgacactgtacttcagagagaaggagatggagaaagagtatcggctctct
gcactccccgccttcaagtactatgcagcttgcaccttcctggtttttctctccaacttc
atcatccagatgctggtaacaaacaggcccccagctctggccatcacctatagcatcacc
ttcctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtc
ttgaaaggccccaagatgctgcactggctgcccacgctctctgtcctggtggccacacag
cccggactgcgagtcgccctgggcactgccacaatcctgctcgtctttgctatggccatt
accagcctggtcttcctaccggcagcatcgaactgccctttccgggctcccaatgtgtcc
tccgtggctttcaacttctcctgggagctccctgggtccctgcctctcatcagtgtccca
tactccatgcactgctgcgtgctggggctcctctcctgctccctcttcctgcacatgagc
ttcgaactgaagctgctgttgctcctgctgtggctggtggcctcctgctccgtcttcctg
cactcccacgcgtggctgtccgactgcctcgtcgcccgcctctatccgggccccttggac
tccaggccaggggtgctgaaggagcccaaactgatgggagcgatctgtttctttatcttc
ttcttcaccctcctcgtcctggctcggcagaatgagtattactgccgcctggacttcctg
tggaagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcgg
ctgctcttggagaatgtactccctgcgcacgtggccccccagttcattggccagaatcgg
cgcaatgaggacctctaccaccagtcctacgagtgtgtttgcgtcctcttcgcctcagtc
ccagactttaaggagttttactctgaatccaacatcaaccatgaggggctagagtgtctg
cggctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagt
ggagtagagaaaatcaaaaccatcggcagcacctacatggcagctacaggcttaaatgcc
acctctggacaggactcacagcaggattctgagcggagctgcagccaccttggcaccatg
gtggagtttgccgtggcccttggatctaagctggacgtcatcaacaagcactcattcaac
aacttccgcttgcgtgtggggttaaaccatggacctgtggtagccggagtgattggggcc
cagaagccacaatatgacatctggggcaacacagtgaacgtggccagccgcatggagagt
acaggcgtactgggaaagatccaagtgactgaagagacagctggggccctgcagtcctta
ggctatacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacc
tacttcctgaacacagatttgactcgagctggacctccctcgtcactctag

DBGET integrated database retrieval system