KEGG   Camelus ferus (Wild Bactrian camel): 102524205Help
Entry
102524205         CDS       T02979                                 

Gene name
ZDHHC18
Definition
(RefSeq) zinc finger DHHC-type containing 18
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102524205 (ZDHHC18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Imm17 HRG
Motif
Other DBs
NCBI-GeneID: 102524205
NCBI-ProteinID: XP_006173779
Position
Un
AA seq 282 aa AA seqDB search
MYEASQPPRLPWSKRLLTGPRRVLPGSTGFSCLGLLALGLAIPHLSLLPLSDNTGSSTYR
PPPRTREVMINGQVVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNY
RFFYAFILSLSFLTAFIFACVVTHLTLRSQGSNFLSTLKETPASVLELVICFFSIWSILG
LSGFHTYLVASNLTTNEDIKGSWSNKRGGEASVNPYSHKSVITNCCAVLCGPLPPSLIDR
RGFVQSDTVLPSPIRSDEPACGAKPNASMEDTCQDFAISCTA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaggcctcacagcccccgaggctgccttggtcaaagaggctgctgacagggccc
aggcgagtcctgccaggcagcactggcttctcctgcctggggctcctggctctgggcttg
gccatcccccatctatctctcctcccactctcagacaacacaggcagttccacgtaccgg
ccaccccctcggacccgggaggtgatgatcaatgggcaggtggtgaaattgaagtactgc
ttcacctgcaagatgtttcggccgccccggacctcacactgcagtgtctgtgacaactgt
gtggagagatttgaccatcactgcccctgggtaggaaattgtgtggggagacggaactac
cgcttcttctatgcgtttatcctctccctctcgttcctgacggccttcatcttcgcctgt
gtggtcacccacctgacgctgcgctctcagggaagcaacttcctctccactctgaaggag
acaccagcgagtgtgctggagttggtgatctgctttttctccatctggtccatcctgggc
ctctcagggtttcacacttacctcgtcgcctccaacctgacgactaatgaagatatcaaa
ggctcgtggtccaacaagagaggcggtgaggcctctgtcaacccctacagccataaaagt
gttatcaccaactgctgtgctgtgctctgcggccccctacctcccagcctgattgaccgg
aggggatttgtgcagtctgacaccgtgttgccatcacccatcagaagcgatgagccagcc
tgcggagccaagcccaacgccagcatggaggacacctgtcaggattttgccatctcctgc
acagcctga

DBGET integrated database retrieval system