KEGG   Camelus ferus (Wild Bactrian camel): 102524235Help
Entry
102524235         CDS       T02979                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr03040  Spliceosome
cfr04010  MAPK signaling pathway
cfr04141  Protein processing in endoplasmic reticulum
cfr04144  Endocytosis
cfr04213  Longevity regulating pathway - multiple species
cfr04612  Antigen processing and presentation
cfr04915  Estrogen signaling pathway
cfr05134  Legionellosis
cfr05145  Toxoplasmosis
cfr05162  Measles
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102524235 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102524235 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102524235 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102524235 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102524235 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102524235 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102524235 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102524235 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    102524235 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102524235 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102524235 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cfr03041]
    102524235 (HSPA2)
   03009 Ribosome biogenesis [BR:cfr03009]
    102524235 (HSPA2)
   03110 Chaperones and folding catalysts [BR:cfr03110]
    102524235 (HSPA2)
   04131 Membrane trafficking [BR:cfr04131]
    102524235 (HSPA2)
   03051 Proteasome [BR:cfr03051]
    102524235 (HSPA2)
   03029 Mitochondrial biogenesis [BR:cfr03029]
    102524235 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102524235 (HSPA2)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102524235 (HSPA2)
Spliceosome [BR:cfr03041]
 Complex B
  Other components
   Prp19 complex
    102524235 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    102524235 (HSPA2)
Ribosome biogenesis [BR:cfr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102524235 (HSPA2)
Chaperones and folding catalysts [BR:cfr03110]
 Heat shock proteins
  HSP70 / DNAK
   102524235 (HSPA2)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102524235 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102524235 (HSPA2)
Proteasome [BR:cfr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102524235 (HSPA2)
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102524235 (HSPA2)
Exosome [BR:cfr04147]
 Exosomal proteins
  Proteins found in most exosomes
   102524235 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG Zincin_2 DUF1464 CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 102524235
NCBI-ProteinID: XP_006177814
UniProt: S9YQE7
Position
Un
AA seq 636 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEI
SSMVLTKMKDIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIAPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKINEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGGSGASGGPTIEEVD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcaccgacaccgagcgcctcatcggcgacgctgccaagaaccaggta
gccatgaaccccaccaacaccatcttcgacgccaagaggctgatcggacggaagttcgag
gacgccacagtgcagtcggacatgaaacactggccattccgcgtggtgagcgagggaggg
aagcccaaagtgcaggtggagtacaagggagagatcaagaccttcttccccgaggagatc
tcctccatggtcctcactaagatgaaggacatcgccgaagcgtacctggggggcaaggtg
cagagcgcggtcatcacggtcccggcctatttcaatgactcgcagcgccaggccaccaag
gacgcgggcaccatcacgggcctcaatgtgctgcgcatcatcaatgagcccacagcggcg
gccatcgcctacggcctcgacaagaagggctgcgccggcggcgagaagaacgtgctcatc
ttcgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacagccggcgacactcacctgggcggagaggacttcgataaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacatagcacccaacaaa
cgcgcggtgcgccgactccgcaccgcctgcgagcgcgccaaacgcaccctgagctcttcc
acgcaggccagcatcgagatcgactcactttacgagggcgtggacttctacacgtccatc
acccgcgcccggtttgaggagctcaacgctgacctgttccgcgggaccctcgagccggtg
gagaaggcgctgcgcgatgccaagttggacaagggccagattcaagagatcgtgctggtc
ggcggctccactcgcatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctatggagccgcagtgcaggct
gccatcctcatcggggacaagtccgagaacgttcaggacctgctgctactcgacgtgacc
ccgttgtcgctgggcatcgagacggctggcggcgtcatgactccactcatcaaaaggaat
accacgatccccaccaagcagacgcagaccttcactacctactcagacaaccagagcagc
gtgctggtgcaagtgtacgagggcgaacgggccatgactaaggacaataacctgctgggc
aagttcgacctgaccgggattcccccggcgccccgcggggtcccccagatagaggtcacc
ttcgacatcgacgccaatggcatcctcaacgtcaccgccgccgacaagagcaccggtaaa
gaaaataagatcaccatcaccaacgacaagggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcggtacaagtcggaagatgaagccaatcgcgaccgggtcgcg
gccaaaaacgccgtggagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattaacgagcaagacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggcttgaccgaaaccagatggcggagaaagatgagtatgaacacaagcagaaa
gagctcgaaagggtgtgcaaccccatcatcagcaaactttatcaaggcggccctggcggc
ggcggcggttctggagcctccgggggaccgaccatcgaggaagtggattaa

DBGET integrated database retrieval system