KEGG   Campylobacter fetus subsp. fetus 04/554: CFF04554_0070Help
Entry
CFF04554_0070     CDS       T03330                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cft  Campylobacter fetus subsp. fetus 04/554
Pathway
cft00620  Pyruvate metabolism
cft00630  Glyoxylate and dicarboxylate metabolism
cft01100  Metabolic pathways
cft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFF04554_0070 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    CFF04554_0070 (aldA)
Enzymes [BR:cft01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     CFF04554_0070 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     CFF04554_0070 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh zf-C4H2
Motif
Other DBs
NCBI-ProteinID: AIR78032
UniProt: A0A0E1GFX4
Position
56592..58040
Genome map
AA seq 482 aa AA seqDB search
MRTYEMYIDGAFVPNRSSKSIEVLNPATKKVISTIPDADISQVEEAISSSKKAQKSWEAL
AAIERANYLRKIANEIRENSEMLAQTITEEQGKIISLARVEVNFTADYLDYMAEWARRYE
GEIIQSDRINENIFIFKQAIGVTSGILPWNFPFFLIARKLAPALVTGNTIVIKASVETPN
NAFEFAKLAHKAGLPKGVFNLVSGRGSTVGNLLASHKDIGLVSFTGSVETGAKIMEAASK
NIIKVNLELGGKAPAIVCRDADIDAAVNYIKNSRIINTGQVCNCAERVYVQKDIIKTFTD
KMVEAMKHVKYGIPTDEKVDMGPLVSEAGLNSVNAMVERAKNSGAKVLTGGRISSNQDGY
YYEPTVITDIDQKSELIQSEIFGPVLPIVAFDSIDNAIEMANDSDYGLTSSIYTQNIDIA
MRACREIKFGETYINRENFEAMQGFHAGFRKSGIGGADGKHGLEEYLATHVVYLQYNKDA
NF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacttacgaaatgtatatagacggtgcttttgttccaaatagaagctctaagagc
attgaagttctaaatccggccacaaaaaaggttatttcgactattccagatgccgatata
tcgcaagtagaagaggcgattagcagtagcaaaaaagctcaaaaatcttgggaggcactt
gcagcgatcgaacgtgcaaattatttaagaaaaatagcaaatgagataagagagaattca
gaaatgttagctcagactattaccgaagagcaaggtaaaatcatatctttagctagagtt
gaggtaaattttacagctgactatcttgattatatggctgaatgggctagaagatatgaa
ggtgagattatacaaagcgatcgcataaatgaaaatatatttatatttaaacaagcaatc
ggagttacaagcggtattttaccttggaatttcccatttttcttaatcgctagaaagttg
gctcctgctcttgttacggggaatactattgttatcaaagccagtgttgaaacgccaaat
aacgcgtttgaatttgccaaacttgcccataaagcaggtcttccaaaaggagtgtttaat
ctagtaagtggacgtggaagtacggttggaaatttactagcaagtcacaaagatataggt
ttagtaagttttactggtagcgtggaaacaggagctaagattatggaagctgctagtaaa
aatatcataaaagtaaatttagaactaggcggtaaagctcctgctattgtttgtagagat
gccgatatagacgcggccgtaaattatataaaaaactcgcgtattatcaatacaggacaa
gtttgtaactgcgctgagagagtttatgtgcaaaaagatattataaaaacttttacagac
aaaatggtagaagcaatgaaacatgtaaaatatggcattccgactgatgaaaaagtagat
atgggtccccttgtaagcgaagccggattaaactcagtaaatgctatggtagaacgtgcg
aaaaatagcggtgctaaggtattaaccggaggacgcatatctagcaatcaagacggttac
tattatgaacctactgttattaccgatatagatcaaaaaagtgagcttatccaaagtgag
atatttggtccggtgcttcctatagtggcttttgacagtatagataatgctatagagatg
gcaaacgatagtgattatgggctaacttcaagtatttatacgcaaaatatagatatagcg
atgagagcatgccgtgagattaaatttggagaaacatatatcaatcgggaaaattttgaa
gctatgcaaggatttcacgccggttttagaaaaagtggtataggcggagccgatggaaag
catgggcttgaagagtatctagctactcacgttgtatatttgcaatacaataaagatgct
aatttttaa

DBGET integrated database retrieval system