KEGG   Campylobacter fetus subsp. fetus 04/554: CFF04554_0604Help
Entry
CFF04554_0604     CDS       T03330                                 

Gene name
gatA
Definition
(GenBank) Glu-tRNA(Gln) amidotransferase, subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cft  Campylobacter fetus subsp. fetus 04/554
Pathway
cft00970  Aminoacyl-tRNA biosynthesis
cft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cft00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFF04554_0604 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cft03029]
    CFF04554_0604 (gatA)
Enzymes [BR:cft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CFF04554_0604 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CFF04554_0604 (gatA)
Mitochondrial biogenesis [BR:cft03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CFF04554_0604 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase YcaO
Motif
Other DBs
NCBI-ProteinID: AIR78528
UniProt: A0A0E1GL59
Position
616842..618203
Genome map
AA seq 453 aa AA seqDB search
MISLKDAIKLSSSDIVELRKNLKDKIKDNRQLGAYIEQLTNSDISDEYAGVPIAIKDNIQ
VKNWSITSCSKILQGYVAPYHATVVEKLLKAGLAPFGRTNMDEFAMGSTTESSFYGKTLN
PLDHTRVPGGSSGGSAAAVSAGLAIAALGSDTGGSIRQPAAFCGCVGFKPTYGRVSRYGL
GAYSSSLDQIGPITRSVEDAALLYDIIAGHDPKDSTSSNLENISTSDKLNSDRKLTIAVI
KNYVDGASQDVKDSLYKVVDKLKEAGHNIIYKDLSNSKYDIAAYYIIATAEASANLSRYD
GVRYGRRADSNSLGQMYSKTRGEGFGVEVQRRMLLGTFVLSSGYYDAYYIKAQKARAFIK
LEYEEILNEADIMLMPVAPSVAYKFGELSDPLSAYLGDIYTIGVNLAGLPAITVPVQSDK
NGLNISAQLIGGAWKEQDVLDAAFGLEKLVKGN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcttaaaagatgcgataaagctaagtagtagcgatatagtagagcttcgtaaa
aatttaaaagataagataaaagataatagacaattaggcgcttatatagaacagctaact
aatagcgatataagtgatgagtatgcaggtgttccaatcgctataaaagacaatattcaa
gtcaaaaattggagcataacaagttgttctaagatcttgcaaggttacgtagctccatat
cacgctacggtcgtagaaaagcttttgaaagccggacttgcaccgtttggtcgtacgaat
atggatgagtttgccatgggaagcacaactgaaagttcgttttacggcaaaactttaaat
ccgcttgatcatactagagttccaggaggcagtagtggcggtagcgctgcagcagtttcg
gctgggctagcgatagctgctttgggaagcgatactggaggaagcatacgccaacctgct
gcgttttgcggatgcgtcggctttaagcctacttacggaagagttagcagatatggactt
ggagcttattctagtagcttagaccagataggaccgataacaagaagcgttgaagatgcc
gcacttctttatgatattatagccggacatgatccaaaagatagcacaagctcaaattta
gaaaatataagcacctcggataaattaaacagcgatagaaaacttacgatagcagttata
aaaaactatgttgatggggctagccaagatgttaaggactcgctttataaggtagttgat
aagctaaaagaagccggtcataacataatttataaagatctttctaactcaaaatacgat
atagctgcttattatattatagctacagcagaagctagtgcgaatcttagtcgttatgac
ggtgttagatatggtaggagagcggactcaaactctcttgggcagatgtattcaaaaaca
agaggcgagggatttggtgtagaagtgcaaagaagaatgcttcttggaacatttgtttta
agtagtggatactatgatgcttattatataaaagcacaaaaagcaagagcatttataaaa
ctagaatatgaggagatattaaatgaagccgatataatgctaatgccagtagctcctagt
gtagcttataaatttggagagttaagcgatccgcttagtgcgtatcttggcgatatatat
actataggtgtaaatttggccggacttcctgctataacagtaccggtgcaaagtgataaa
aatgggctaaatatctcagctcagctcatcggcggtgcgtggaaagaacaagatgtctta
gacgctgcatttggtttggaaaaattagttaaaggaaactaa

DBGET integrated database retrieval system