KEGG   Campylobacter fetus subsp. fetus 04/554: CFF04554_0611Help
Entry
CFF04554_0611     CDS       T03330                                 

Definition
(GenBank) NADH:flavin oxidoreductase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
cft  Campylobacter fetus subsp. fetus 04/554
Brite
KEGG Orthology (KO) [BR:cft00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFF04554_0611
Enzymes [BR:cft01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     CFF04554_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus G3P_antiterm TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AIR78535
UniProt: A0A0E1GHD6
Position
623394..624410
Genome map
AA seq 338 aa AA seqDB search
MSSLFKSLKLANFTIPNRITMPPMCVYKSRDLQGLPRCFHRLHYPARSLGGVGFIIVEAT
AVSPEGCISKNDIGLWSDIQVEAHKKLNYEIKKYSCKVTSVQLAHAGAKGTCDGIISPSG
VRFSGEYGTPDILNTQEIYSIVTKFKEAAIRAKDSDYDLIEIHGAHGYLINQFLSPLTNK
REDEFGGNLENRMRFLNLIIEELKDIIPFGVRLSADEWEDGGNTTEDIKIVAKKCEELGA
SYISVSAGGVVENPTHMPKIKPLYQAQYAKDIKEVINIPVIAAGLITTKEQGEYLLDNGF
CDLVAYGRELLRNPNFALYAAASTGLNDLIDFSYKKAF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtctgtttaaatcattaaagttagctaattttacgattccaaatcgtatcaca
atgcctccgatgtgtgtatataaaagtagagaccttcaaggacttccgagatgctttcat
aggcttcattatccagcaagatcccttggcggtgttggatttatcatagttgaagccact
gcggtttctcctgagggctgtataagcaaaaacgatataggactttggagcgatatacaa
gtggaagctcataaaaaattaaactatgagattaaaaaatacagttgtaaagtaactagc
gtgcagttggctcacgcaggtgctaaaggaacttgcgatggtataataagccctagcggc
gttagatttagcggtgagtacggcactcctgatattttgaatactcaagaaatttactct
atagtgactaaatttaaagaagcagctattagagctaaagattcagattatgatttaatc
gagattcacggggctcacggttatctaataaatcagtttttaagtccgcttacaaataaa
agagaagatgagtttggcgggaatttagaaaatagaatgagatttttaaatttaattata
gaagagttaaaagatatcattccgtttggtgtaagacttagcgccgacgagtgggaagat
ggcggcaatactactgaggatataaaaatagtagcaaaaaaatgcgaagagttaggagct
agttatatcagcgtttcagccggcggagtagtagaaaatcctactcatatgccaaaaata
aaaccgctttatcaagcgcaatacgctaaagatatcaaagaagttataaatataccagtc
atcgcagccgggcttataactacaaaagagcaaggagaatatcttttggataatggattt
tgtgatttagtagcttatggcagagagcttttaagaaatccgaattttgccctatatgca
gctgcaagcacagggctaaatgatcttatagatttctcttataaaaaagcgttttag

DBGET integrated database retrieval system